SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0095
         (760 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY075291-1|AAL68158.2| 1193|Drosophila melanogaster AT30755p pro...    32   0.98 
AE014297-3139|AAN14374.2| 1304|Drosophila melanogaster CG31169-P...    32   0.98 
AE014297-3138|AAF55983.2| 1469|Drosophila melanogaster CG31169-P...    32   0.98 
BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p pro...    31   1.3  
BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p pro...    31   1.3  
AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine nucl...    31   1.3  
AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,...    31   1.3  
AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,...    31   1.3  
BT003220-1|AAO24975.1|  513|Drosophila melanogaster RE02054p pro...    30   3.9  
AY061284-1|AAL28832.1|  513|Drosophila melanogaster LD20239p pro...    30   3.9  
AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-P...    30   3.9  
AE013599-3047|AAF57443.3|  513|Drosophila melanogaster CG11175-P...    30   3.9  
BT011128-1|AAR82795.1| 1084|Drosophila melanogaster LD07113p pro...    29   6.9  
AY119616-1|AAM50270.1|  809|Drosophila melanogaster LD43174p pro...    29   6.9  
AE014297-2400|AAN13751.2|  809|Drosophila melanogaster CG7660-PB...    29   6.9  
AE014297-2399|AAF55458.2|  831|Drosophila melanogaster CG7660-PA...    29   6.9  

>AY075291-1|AAL68158.2| 1193|Drosophila melanogaster AT30755p protein.
          Length = 1193

 Score = 31.9 bits (69), Expect = 0.98
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = -1

Query: 247  SKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 95
            SK EA +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 942  SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 990


>AE014297-3139|AAN14374.2| 1304|Drosophila melanogaster CG31169-PB,
            isoform B protein.
          Length = 1304

 Score = 31.9 bits (69), Expect = 0.98
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = -1

Query: 247  SKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 95
            SK EA +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 1053 SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 1101


>AE014297-3138|AAF55983.2| 1469|Drosophila melanogaster CG31169-PA,
            isoform A protein.
          Length = 1469

 Score = 31.9 bits (69), Expect = 0.98
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = -1

Query: 247  SKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 95
            SK EA +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 1218 SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 1266


>BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p
           protein.
          Length = 1416

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 232 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 92
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 498 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 544


>BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p
           protein.
          Length = 1506

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 232 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 92
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine
           nucleotide exchange factorDC3G protein.
          Length = 1383

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 232 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 92
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 464 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 510


>AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,
           isoform A protein.
          Length = 1571

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 232 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 92
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,
           isoform B protein.
          Length = 1520

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 232 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 92
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>BT003220-1|AAO24975.1|  513|Drosophila melanogaster RE02054p
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 25/97 (25%), Positives = 36/97 (37%)
 Frame = +3

Query: 24  HRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 203
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGSTS 344

Query: 204 SISLPDSARLASALEAFGIIPRMVASHHRPLGRVHEP 314
           +    D    +   +     P    SHHRP G   +P
Sbjct: 345 N----DPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


>AY061284-1|AAL28832.1|  513|Drosophila melanogaster LD20239p
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 25/97 (25%), Positives = 36/97 (37%)
 Frame = +3

Query: 24  HRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 203
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGSTS 344

Query: 204 SISLPDSARLASALEAFGIIPRMVASHHRPLGRVHEP 314
           +    D    +   +     P    SHHRP G   +P
Sbjct: 345 N----DPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


>AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-PA
           protein.
          Length = 1333

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +1

Query: 292 RSAECMNQMSETAVPLVLSSITIATTSHQ*G 384
           +  EC  Q+S  ++ LV+S+IT+AT +H  G
Sbjct: 701 QQCECHAQVSIASLLLVISAITVATNTHDYG 731


>AE013599-3047|AAF57443.3|  513|Drosophila melanogaster CG11175-PA
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 25/97 (25%), Positives = 36/97 (37%)
 Frame = +3

Query: 24  HRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 203
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGSTS 344

Query: 204 SISLPDSARLASALEAFGIIPRMVASHHRPLGRVHEP 314
           +    D    +   +     P    SHHRP G   +P
Sbjct: 345 N----DPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


>BT011128-1|AAR82795.1| 1084|Drosophila melanogaster LD07113p protein.
          Length = 1084

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = -1

Query: 247  SKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRR 116
            SK EA +    KD+   EP ES  SK+   TS  S SK+E++++
Sbjct: 1040 SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKKK 1081


>AY119616-1|AAM50270.1|  809|Drosophila melanogaster LD43174p
           protein.
          Length = 809

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 1   LQTIPSPDIELSYIRTFGAVMHVLRKKPIASISAIQMGFDVASRVLNAKR 150
           L  +PSPD +LSY +    V H +   P+   S      D ASR L A R
Sbjct: 381 LSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSS------DEASRSLRAFR 424


>AE014297-2400|AAN13751.2|  809|Drosophila melanogaster CG7660-PB,
           isoform B protein.
          Length = 809

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 1   LQTIPSPDIELSYIRTFGAVMHVLRKKPIASISAIQMGFDVASRVLNAKR 150
           L  +PSPD +LSY +    V H +   P+   S      D ASR L A R
Sbjct: 381 LSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSS------DEASRSLRAFR 424


>AE014297-2399|AAF55458.2|  831|Drosophila melanogaster CG7660-PA,
           isoform A protein.
          Length = 831

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 1   LQTIPSPDIELSYIRTFGAVMHVLRKKPIASISAIQMGFDVASRVLNAKR 150
           L  +PSPD +LSY +    V H +   P+   S      D ASR L A R
Sbjct: 381 LSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSS------DEASRSLRAFR 424


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,532,983
Number of Sequences: 53049
Number of extensions: 749711
Number of successful extensions: 1787
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1735
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1787
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3478915869
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).