SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubul...    29   4.8  
M22335-1|AAA28993.1|  454|Drosophila melanogaster protein ( D.me...    29   4.8  
M20419-1|AAA28989.1|  447|Drosophila melanogaster protein ( D.me...    29   4.8  
BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p pro...    29   4.8  
AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p pro...    29   4.8  
AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA...    29   4.8  
AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD...    29   4.8  
AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC...    29   4.8  
AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA...    29   4.8  
AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB...    29   4.8  
AE013599-2148|AAM70939.1| 2403|Drosophila melanogaster CG18255-P...    29   4.8  
AE013599-2147|AAF58087.2| 7210|Drosophila melanogaster CG18255-P...    29   4.8  
AE013599-2142|AAM70937.1| 4463|Drosophila melanogaster CG18255-P...    29   4.8  
AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-P...    29   4.8  
AE014298-259|AAF45667.1|  216|Drosophila melanogaster CG14811-PA...    29   6.4  

>X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubulin
           protein.
          Length = 435

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F        TTA+Q   +    Q  +  
Sbjct: 322 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSSTFIGN-----TTAIQELFKRISEQFSAMF 376

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 377 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 411


>M22335-1|AAA28993.1|  454|Drosophila melanogaster protein (
           D.melanogaster beta-3 tubulin gene, exons 2, 3 and 4. ).
          Length = 454

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F        TTA+Q   +    Q  +  
Sbjct: 341 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSSTFIGN-----TTAIQELFKRISEQFSAMF 395

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 396 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 430


>M20419-1|AAA28989.1|  447|Drosophila melanogaster protein (
           D.melanogaster beta-1 tubulin mRNA, complete cds. ).
          Length = 447

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p
           protein.
          Length = 447

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p
           protein.
          Length = 457

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           S+ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 SKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNS-----TAIQEIFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN 312
             K   HW    G+D M F  +  N+N
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMN 416


>AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA
           protein.
          Length = 522

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           S+ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 400 SKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNS-----TAIQEIFKRISEQFTAMF 454

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN 312
             K   HW    G+D M F  +  N+N
Sbjct: 455 RRKAFLHWYTGEGMDEMEFTEAESNMN 481


>AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD,
           isoform D protein.
          Length = 375

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC,
           isoform C protein.
          Length = 375

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA,
           isoform A protein.
          Length = 456

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 344 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 398

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 399 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 433


>AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB,
           isoform B protein.
          Length = 447

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AE013599-2148|AAM70939.1| 2403|Drosophila melanogaster CG18255-PE,
            isoform E protein.
          Length = 2403

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = -3

Query: 199  LTVERR--SYRIVPIAHETKPTRPYG*EDPRKAGERGS 92
            +TVE R  + RI P   E +P RP G E+P  AGE G+
Sbjct: 1433 ITVEPRVRAPRISP-PREGRPPRPSGDEEPAAAGEEGA 1469


>AE013599-2147|AAF58087.2| 7210|Drosophila melanogaster CG18255-PD,
            isoform D protein.
          Length = 7210

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = -3

Query: 199  LTVERR--SYRIVPIAHETKPTRPYG*EDPRKAGERGS 92
            +TVE R  + RI P   E +P RP G E+P  AGE G+
Sbjct: 6240 ITVEPRVRAPRISP-PREGRPPRPSGDEEPAAAGEEGA 6276


>AE013599-2142|AAM70937.1| 4463|Drosophila melanogaster CG18255-PC,
            isoform C protein.
          Length = 4463

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = -3

Query: 199  LTVERR--SYRIVPIAHETKPTRPYG*EDPRKAGERGS 92
            +TVE R  + RI P   E +P RP G E+P  AGE G+
Sbjct: 1433 ITVEPRVRAPRISP-PREGRPPRPSGDEEPAAAGEEGA 1469


>AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-PA,
            isoform A protein.
          Length = 9270

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = -3

Query: 199  LTVERR--SYRIVPIAHETKPTRPYG*EDPRKAGERGS 92
            +TVE R  + RI P   E +P RP G E+P  AGE G+
Sbjct: 6240 ITVEPRVRAPRISP-PREGRPPRPSGDEEPAAAGEEGA 6276


>AE014298-259|AAF45667.1|  216|Drosophila melanogaster CG14811-PA
           protein.
          Length = 216

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 564 SHLCYTSHVSLQCQTRVKLTGSSFPADSPKPVPLAVVSLDSR 439
           S  C  +  S+Q   R+ +T + FP D PKP P    SL  R
Sbjct: 118 SQACNPTSRSMQPPRRISIT-NEFPDDQPKPAPKRRYSLVRR 158


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,075,028
Number of Sequences: 53049
Number of extensions: 730519
Number of successful extensions: 2032
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1932
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2020
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).