SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT023953-1|ABB36457.1|  509|Drosophila melanogaster GH08757p pro...    31   1.7  
AE014298-1714|AAF48114.1| 1373|Drosophila melanogaster CG15737-P...    29   4.0  
U04809-1|AAA19430.1|  622|Drosophila melanogaster cocaine-sensit...    29   5.2  
AY071023-1|AAL48645.1|  622|Drosophila melanogaster RE10485p pro...    29   5.2  
AE013599-3863|AAF47200.1|  622|Drosophila melanogaster CG4545-PA...    29   5.2  
AY058593-1|AAL13822.1|  767|Drosophila melanogaster LD28817p pro...    28   9.1  
AE014297-1398|AAF54712.1|  767|Drosophila melanogaster CG6962-PA...    28   9.1  

>BT023953-1|ABB36457.1|  509|Drosophila melanogaster GH08757p
           protein.
          Length = 509

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 18/73 (24%), Positives = 32/73 (43%)
 Frame = -2

Query: 627 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNRITREF*TATSVSATSPL 448
           S F P+ P   +  A        Y+ +  P  + +P  S  +++      ATS ++T+  
Sbjct: 427 SHFLPYVPTTTASTATATNAIATYAASATPSPTPTPPPSAGHQLPMGHANATSTTSTANT 486

Query: 447 CTLGTKHRAPADI 409
            T  T + +PA I
Sbjct: 487 TTTTTTYVSPAGI 499


>AE014298-1714|AAF48114.1| 1373|Drosophila melanogaster CG15737-PA
           protein.
          Length = 1373

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +3

Query: 426 GVSFQACXVVTWRKRSSPFKTPA*SGSRHCHAGSLTG-AVHLSKNNAGVLRPA 581
           G   QA     W   SSP   PA  GS  C +G+  G + H +  NAG LRPA
Sbjct: 775 GQGHQAPPATMWPHSSSPCY-PASYGSS-CGSGTGAGTSPHNNDGNAGALRPA 825


>U04809-1|AAA19430.1|  622|Drosophila melanogaster cocaine-sensitive
           serotonin transporterprotein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -2

Query: 429 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 325
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


>AY071023-1|AAL48645.1|  622|Drosophila melanogaster RE10485p
           protein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -2

Query: 429 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 325
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


>AE013599-3863|AAF47200.1|  622|Drosophila melanogaster CG4545-PA
           protein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -2

Query: 429 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 325
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


>AY058593-1|AAL13822.1|  767|Drosophila melanogaster LD28817p
           protein.
          Length = 767

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = -3

Query: 194 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 60
           R  G L N + ++    T+   TLRE   +P   R C++ F  TF
Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580


>AE014297-1398|AAF54712.1|  767|Drosophila melanogaster CG6962-PA
           protein.
          Length = 767

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = -3

Query: 194 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 60
           R  G L N + ++    T+   TLRE   +P   R C++ F  TF
Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,668,881
Number of Sequences: 53049
Number of extensions: 585881
Number of successful extensions: 1400
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1400
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2641708800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).