SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT012669-1|AAT08475.1|   46|Drosophila melanogaster LD48059p pro...    64   2e-10
Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein.     29   4.0  
Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein.     29   4.0  
AY051596-1|AAK93020.1|  969|Drosophila melanogaster GH23814p pro...    29   4.0  
AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB,...    29   4.0  
AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA,...    29   4.0  
AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC,...    29   4.0  
L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-h...    29   7.0  
BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p pro...    29   7.0  
AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p pro...    29   7.0  
AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA ...    29   7.0  

>BT012669-1|AAT08475.1|   46|Drosophila melanogaster LD48059p
           protein.
          Length = 46

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 29/38 (76%), Positives = 32/38 (84%)
 Frame = -1

Query: 442 EHKCWDPKDGELCLVRSKSGETLMEDRSDSDVQIDRRN 329
           EH C DPKDGEL L+R KSGETLMEDR+ SDVQID +N
Sbjct: 9   EHICCDPKDGELYLIRLKSGETLMEDRNSSDVQIDCQN 46


>Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein.
          Length = 3347

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190  NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
            NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 2712 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 2767


>Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein.
          Length = 3554

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190  NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
            NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 2919 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 2974


>AY051596-1|AAK93020.1|  969|Drosophila melanogaster GH23814p
           protein.
          Length = 969

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190 NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
           NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 334 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 389


>AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB,
            isoform B protein.
          Length = 3522

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190  NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
            NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 2887 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 2942


>AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA,
            isoform A protein.
          Length = 3584

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190  NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
            NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 2949 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 3004


>AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC,
            isoform C protein.
          Length = 3719

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -1

Query: 190  NDLNLFSNFKWVRTPAYSNDEAGDL-MTVPSGPILVSR-TGAVG*TKRSVKAPKKRSWDT 17
            NDLN +  F WV T    N E+ DL +++PS    +S+  GA+  ++R+    +  SWD+
Sbjct: 3084 NDLNQYPIFPWVLT----NYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDS 3139


>L77907-1|AAC37264.1| 1883|Drosophila melanogaster
           chromodomain-helicase-DNA-bindingprotein protein.
          Length = 1883

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +1

Query: 409 VHHLSGPSICAQSAPSFTDWKRD 477
           +HHL GP +C     + T W+R+
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595


>BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p
           protein.
          Length = 1645

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +1

Query: 409 VHHLSGPSICAQSAPSFTDWKRD 477
           +HHL GP +C     + T W+R+
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595


>AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p
           protein.
          Length = 1101

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +1

Query: 409 VHHLSGPSICAQSAPSFTDWKRD 477
           +HHL GP +C     + T W+R+
Sbjct: 41  IHHLYGPFLCVVPLSTMTAWQRE 63


>AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA
           protein.
          Length = 1883

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +1

Query: 409 VHHLSGPSICAQSAPSFTDWKRD 477
           +HHL GP +C     + T W+R+
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,097,947
Number of Sequences: 53049
Number of extensions: 622988
Number of successful extensions: 1246
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1231
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1246
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).