SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-666|AAM68827.1|   75|Drosophila melanogaster CG8687-PA,...    31   1.2  
AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p pro...    29   4.9  
AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple ast...    29   4.9  
AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpressio...    29   4.9  
AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-P...    29   4.9  
AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-P...    29   4.9  
AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-P...    29   4.9  
AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule ...    29   4.9  
AE014296-1481|AAN12009.1|  804|Drosophila melanogaster CG32353-P...    28   8.6  

>AE013599-666|AAM68827.1|   75|Drosophila melanogaster CG8687-PA,
           isoform A protein.
          Length = 75

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/29 (51%), Positives = 19/29 (65%)
 Frame = -3

Query: 501 YTEGISMFSLA*RPGQPAETPVPGVGNLR 415
           Y+  I +FS   R G P ETP+P VGN+R
Sbjct: 16  YSLHIKIFSYWKRKGVPHETPLPIVGNMR 44


>AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p
           protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple asters
           protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpression
           suppressor of ras 7 protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-PC,
           isoform C protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-PB,
           isoform B protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-PA,
           isoform A protein.
          Length = 1491

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule
           associated-proteinorbit protein.
          Length = 1492

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +1

Query: 337 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGP 516
           R+  N G  P   P    P PR  AG  ++ S+ GS S  P    + ++    +  RG  
Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAG--VSQSQPGSRSTSPSTKLRDQYGGIGNYYRGAT 688

Query: 517 GHLRASQTCYCSISCGSKTPVPLR 588
           G +    +     +  S+   P R
Sbjct: 689 GAIPKKASGIPRSTASSRETSPTR 712


>AE014296-1481|AAN12009.1|  804|Drosophila melanogaster CG32353-PA
           protein.
          Length = 804

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -2

Query: 241 VIQIHQN*RLRTRGPPSIGFDL 176
           ++QI  N +  TR PPSIG DL
Sbjct: 353 IVQIRDNIQAETRRPPSIGGDL 374


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,052,116
Number of Sequences: 53049
Number of extensions: 635537
Number of successful extensions: 1881
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1880
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2482967880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).