SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT004893-1|AAO47871.1|  541|Drosophila melanogaster RE51884p pro...   159   4e-39
AY069079-1|AAL39224.1|  541|Drosophila melanogaster GH09383p pro...   159   4e-39
AE014297-3582|AAN14008.1|  541|Drosophila melanogaster CG6668-PB...   159   4e-39
AE014297-3581|AAF56318.1|  541|Drosophila melanogaster CG6668-PA...   159   4e-39
AE014296-2342|AAF49773.3| 3146|Drosophila melanogaster CG9007-PA...    29   4.0  
AE014297-811|AAF54284.1|  494|Drosophila melanogaster CG11768-PA...    29   5.3  
AY069153-1|AAL39298.1|  305|Drosophila melanogaster GH17155p pro...    28   9.2  
AE013599-3722|AAF47093.1|  305|Drosophila melanogaster CG5339-PA...    28   9.2  

>BT004893-1|AAO47871.1|  541|Drosophila melanogaster RE51884p
           protein.
          Length = 541

 Score =  159 bits (385), Expect = 4e-39
 Identities = 74/85 (87%), Positives = 80/85 (94%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GFSWRGGSERDTTGILMWS+IF     +G+K+AIILLDTQGAFDS+STVRDCATVFA
Sbjct: 81  PLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFA 140

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSSVQIYNLSQNIQEDDLQHL
Sbjct: 141 LSTMLSSVQIYNLSQNIQEDDLQHL 165



 Score =  153 bits (370), Expect = 3e-37
 Identities = 68/83 (81%), Positives = 76/83 (91%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL D G+ PFQRLQFLVRDWSFPYEA YGA GG +IL RRL+VSDKQHPELQ
Sbjct: 167 LFTEYGRLALADTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQ 226

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           SLR+HI++CF+E+ACFLMPHPGL
Sbjct: 227 SLRRHISSCFTEVACFLMPHPGL 249



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           V+SVAGAFRKGKSFLLDFFLRYM+ KY
Sbjct: 40  VVSVAGAFRKGKSFLLDFFLRYMYSKY 66


>AY069079-1|AAL39224.1|  541|Drosophila melanogaster GH09383p
           protein.
          Length = 541

 Score =  159 bits (385), Expect = 4e-39
 Identities = 74/85 (87%), Positives = 80/85 (94%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GFSWRGGSERDTTGILMWS+IF     +G+K+AIILLDTQGAFDS+STVRDCATVFA
Sbjct: 81  PLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFA 140

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSSVQIYNLSQNIQEDDLQHL
Sbjct: 141 LSTMLSSVQIYNLSQNIQEDDLQHL 165



 Score =  153 bits (370), Expect = 3e-37
 Identities = 68/83 (81%), Positives = 76/83 (91%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL D G+ PFQRLQFLVRDWSFPYEA YGA GG +IL RRL+VSDKQHPELQ
Sbjct: 167 LFTEYGRLALADTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQ 226

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           SLR+HI++CF+E+ACFLMPHPGL
Sbjct: 227 SLRRHISSCFTEVACFLMPHPGL 249



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           V+SVAGAFRKGKSFLLDFFLRYM+ KY
Sbjct: 40  VVSVAGAFRKGKSFLLDFFLRYMYSKY 66


>AE014297-3582|AAN14008.1|  541|Drosophila melanogaster CG6668-PB,
           isoform B protein.
          Length = 541

 Score =  159 bits (385), Expect = 4e-39
 Identities = 74/85 (87%), Positives = 80/85 (94%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GFSWRGGSERDTTGILMWS+IF     +G+K+AIILLDTQGAFDS+STVRDCATVFA
Sbjct: 81  PLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFA 140

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSSVQIYNLSQNIQEDDLQHL
Sbjct: 141 LSTMLSSVQIYNLSQNIQEDDLQHL 165



 Score =  153 bits (370), Expect = 3e-37
 Identities = 68/83 (81%), Positives = 76/83 (91%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL D G+ PFQRLQFLVRDWSFPYEA YGA GG +IL RRL+VSDKQHPELQ
Sbjct: 167 LFTEYGRLALADTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQ 226

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           SLR+HI++CF+E+ACFLMPHPGL
Sbjct: 227 SLRRHISSCFTEVACFLMPHPGL 249



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           V+SVAGAFRKGKSFLLDFFLRYM+ KY
Sbjct: 40  VVSVAGAFRKGKSFLLDFFLRYMYSKY 66


>AE014297-3581|AAF56318.1|  541|Drosophila melanogaster CG6668-PA,
           isoform A protein.
          Length = 541

 Score =  159 bits (385), Expect = 4e-39
 Identities = 74/85 (87%), Positives = 80/85 (94%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL+GFSWRGGSERDTTGILMWS+IF     +G+K+AIILLDTQGAFDS+STVRDCATVFA
Sbjct: 81  PLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFA 140

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTMLSSVQIYNLSQNIQEDDLQHL
Sbjct: 141 LSTMLSSVQIYNLSQNIQEDDLQHL 165



 Score =  153 bits (370), Expect = 3e-37
 Identities = 68/83 (81%), Positives = 76/83 (91%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLAL D G+ PFQRLQFLVRDWSFPYEA YGA GG +IL RRL+VSDKQHPELQ
Sbjct: 167 LFTEYGRLALADTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQ 226

Query: 73  SLRKHITACFSELACFLMPHPGL 5
           SLR+HI++CF+E+ACFLMPHPGL
Sbjct: 227 SLRRHISSCFTEVACFLMPHPGL 249



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYKY 555
           V+SVAGAFRKGKSFLLDFFLRYM+ KY
Sbjct: 40  VVSVAGAFRKGKSFLLDFFLRYMYSKY 66


>AE014296-2342|AAF49773.3| 3146|Drosophila melanogaster CG9007-PA
           protein.
          Length = 3146

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/58 (29%), Positives = 35/58 (60%)
 Frame = +2

Query: 314 DSIVDRANTVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSEPP 487
           +SIV  +N +AQS ++ +L+     S +  AT +P+ +  L+++  +++PV   + PP
Sbjct: 625 NSIVGSSNNLAQSNSMSNLAGPRSNSGSGFATTTPTPATPLHLTP-VNVPVHVEAAPP 681


>AE014297-811|AAF54284.1|  494|Drosophila melanogaster CG11768-PA
           protein.
          Length = 494

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 4/69 (5%)
 Frame = -3

Query: 205 PFQRLQFLVRDWSFPYEAPYGAD---GGMQILSRRLKVSDKQHPELQ-SLRKHITACFSE 38
           P Q+LQ L R+  FP  AP   +   G M+      + +D QH E Q +L+ H++  +S 
Sbjct: 421 PIQQLQELRRNPKFPRGAPPCVNYLAGSMENARGEEQRNDWQHSESQVTLQPHLST-YSG 479

Query: 37  LACFLMPHP 11
            A  L+P P
Sbjct: 480 AAGLLIPVP 488


>AY069153-1|AAL39298.1|  305|Drosophila melanogaster GH17155p
           protein.
          Length = 305

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 306 ERTTASWTERTRSRSLAPWIHCRRRLA 386
           + TT SW ERT++ S   W H    LA
Sbjct: 53  DATTVSWLERTKALSANIWTHLWHALA 79


>AE013599-3722|AAF47093.1|  305|Drosophila melanogaster CG5339-PA
           protein.
          Length = 305

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 306 ERTTASWTERTRSRSLAPWIHCRRRLA 386
           + TT SW ERT++ S   W H    LA
Sbjct: 53  DATTVSWLERTKALSANIWTHLWHALA 79


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,911,137
Number of Sequences: 53049
Number of extensions: 555943
Number of successful extensions: 1706
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1583
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1706
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).