SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071422-1|AAL49044.1|  318|Drosophila melanogaster RE50056p pro...    31   0.40 
AE014298-1937|AAF48299.1|  340|Drosophila melanogaster CG11164-P...    31   0.40 
BT024990-1|ABE01220.1|  347|Drosophila melanogaster IP11205p pro...    31   0.53 
AE014298-2829|AAN09486.1|  347|Drosophila melanogaster CG32537-P...    31   0.53 
BT001340-1|AAN71095.1|  916|Drosophila melanogaster AT22221p pro...    28   3.8  
AY095516-1|AAM12250.1| 1084|Drosophila melanogaster GH13857p pro...    28   3.8  
AY058253-1|AAL13482.1|  888|Drosophila melanogaster GH01409p pro...    28   3.8  
AE014297-2044|AAF55196.2|  888|Drosophila melanogaster CG5166-PA...    28   3.8  
AE014297-2043|AAN13664.2| 1023|Drosophila melanogaster CG5166-PC...    28   3.8  
AE014297-2042|AAN13663.1| 1084|Drosophila melanogaster CG5166-PB...    28   3.8  
AE014298-935|AAF46190.2| 1034|Drosophila melanogaster CG14442-PA...    28   5.0  
AY150706-1|AAN78356.1|  210|Drosophila melanogaster CG13732 prot...    27   6.6  
DQ888194-1|ABJ09565.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888192-1|ABJ09563.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888191-1|ABJ09562.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888190-1|ABJ09561.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888189-1|ABJ09560.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888188-1|ABJ09559.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888187-1|ABJ09558.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888186-1|ABJ09557.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888185-1|ABJ09556.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888184-1|ABJ09555.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888183-1|ABJ09554.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888182-1|ABJ09553.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888181-1|ABJ09552.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888180-1|ABJ09551.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
DQ888179-1|ABJ09550.1|  210|Drosophila melanogaster Quijote prot...    27   8.7  
BT025842-1|ABF85742.1|  818|Drosophila melanogaster IP12350p pro...    27   8.7  
BT024328-1|ABC86390.1|  593|Drosophila melanogaster IP10742p pro...    27   8.7  
AY752601-1|AAW32047.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY752599-1|AAW32045.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY752598-1|AAW32044.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY752597-1|AAW32043.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY752595-1|AAW32041.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY752594-1|AAW32040.1|  233|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150712-1|AAN78362.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150711-1|AAN78361.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150709-1|AAN78359.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150708-1|AAN78358.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150707-1|AAN78357.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150705-1|AAN78355.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150704-1|AAN78354.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150703-1|AAN78353.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150702-1|AAN78352.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY150701-1|AAN78351.1|  210|Drosophila melanogaster CG13732 prot...    27   8.7  
AY118419-1|AAM48448.1|  167|Drosophila melanogaster RE73934p pro...    27   8.7  
AY071054-1|AAL48676.1|  279|Drosophila melanogaster RE13914p pro...    27   8.7  
AY069384-1|AAL39529.1|  469|Drosophila melanogaster LD09414p pro...    27   8.7  
AJ276419-1|CAC08819.1|  167|Drosophila melanogaster TBP associat...    27   8.7  
AJ243836-1|CAB55760.2|  167|Drosophila melanogaster TATA binding...    27   8.7  
AF215688-1|AAF22851.1|  279|Drosophila melanogaster Miple2 protein.    27   8.7  
AE014297-1917|AAF55111.1|  469|Drosophila melanogaster CG7265-PA...    27   8.7  
AE014296-2917|AAF49334.2|  233|Drosophila melanogaster CG13732-P...    27   8.7  
AE014296-71|AAF47369.1|  279|Drosophila melanogaster CG18321-PA ...    27   8.7  
AE014134-466|AAF51210.1|  167|Drosophila melanogaster CG2859-PA ...    27   8.7  
AE013599-2057|AAF58137.1|  390|Drosophila melanogaster CG12958-P...    27   8.7  

>AY071422-1|AAL49044.1|  318|Drosophila melanogaster RE50056p
           protein.
          Length = 318

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = -1

Query: 263 AVLVRHEISQMTEELLALFEPRETWFSDAEVQTSVQSY 150
           A+ + H   +M E L+A  EPR +WF D+EV ++ + Y
Sbjct: 41  ALFITHPDGRMME-LVAFTEPRRSWFVDSEVCSNGRIY 77


>AE014298-1937|AAF48299.1|  340|Drosophila melanogaster CG11164-PA
           protein.
          Length = 340

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = -1

Query: 263 AVLVRHEISQMTEELLALFEPRETWFSDAEVQTSVQSY 150
           A+ + H   +M E L+A  EPR +WF D+EV ++ + Y
Sbjct: 63  ALFITHPDGRMME-LVAFTEPRRSWFVDSEVCSNGRIY 99


>BT024990-1|ABE01220.1|  347|Drosophila melanogaster IP11205p
           protein.
          Length = 347

 Score = 31.1 bits (67), Expect = 0.53
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +2

Query: 137 DNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSAR 298
           D+K  KIE+ +++Q  K K     KA      S   H    R Q  +QSE+  R
Sbjct: 241 DSKGQKIERCYDVQARKAK-TRKTKASSTRHPSSSVHKRKPRSQQSQQSEQEQR 293


>AE014298-2829|AAN09486.1|  347|Drosophila melanogaster CG32537-PA
           protein.
          Length = 347

 Score = 31.1 bits (67), Expect = 0.53
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +2

Query: 137 DNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSAR 298
           D+K  KIE+ +++Q  K K     KA      S   H    R Q  +QSE+  R
Sbjct: 241 DSKGQKIERCYDVQARKAK-TRKTKASSTRHPSSSVHKRKPRSQQSQQSEQEQR 293


>BT001340-1|AAN71095.1|  916|Drosophila melanogaster AT22221p
           protein.
          Length = 916

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 421 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 469


>AY095516-1|AAM12250.1| 1084|Drosophila melanogaster GH13857p
           protein.
          Length = 1084

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 589 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 637


>AY058253-1|AAL13482.1|  888|Drosophila melanogaster GH01409p
           protein.
          Length = 888

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 528 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 576


>AE014297-2044|AAF55196.2|  888|Drosophila melanogaster CG5166-PA,
           isoform A protein.
          Length = 888

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 528 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 576


>AE014297-2043|AAN13664.2| 1023|Drosophila melanogaster CG5166-PC,
           isoform C protein.
          Length = 1023

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 528 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 576


>AE014297-2042|AAN13663.1| 1084|Drosophila melanogaster CG5166-PB,
           isoform B protein.
          Length = 1084

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
           R++  QM EL+     F  A      PQ   +   + ++HQ Q+Q +++
Sbjct: 589 RTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRA 637


>AE014298-935|AAF46190.2| 1034|Drosophila melanogaster CG14442-PA
           protein.
          Length = 1034

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 131 LPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEK 289
           L D  +   E+   L+H+     S+      P SS  S D+   HQ Q+Q ++
Sbjct: 276 LNDYAKKVREKKKVLKHVVVHGGSSSVVVSTPTSSSSSTDQQHHHQQQQQQQQ 328


>AY150706-1|AAN78356.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATMEE 58


>DQ888194-1|ABJ09565.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888192-1|ABJ09563.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888191-1|ABJ09562.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888190-1|ABJ09561.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888189-1|ABJ09560.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888188-1|ABJ09559.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888187-1|ABJ09558.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888186-1|ABJ09557.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888185-1|ABJ09556.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888184-1|ABJ09555.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888183-1|ABJ09554.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888182-1|ABJ09553.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888181-1|ABJ09552.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888180-1|ABJ09551.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>DQ888179-1|ABJ09550.1|  210|Drosophila melanogaster Quijote
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>BT025842-1|ABF85742.1|  818|Drosophila melanogaster IP12350p
           protein.
          Length = 818

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 47  SRHDV--FLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQG 220
           S+H +  +++A + + V++   T+G +     D    +++++ E+ +      S    QG
Sbjct: 421 SQHSLTEYIDAHNAY-VQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQG 479

Query: 221 APQSSGKSHDEPRRHQN 271
           A   +GK++D+ +R+ +
Sbjct: 480 AEVIAGKANDQAKRYNS 496


>BT024328-1|ABC86390.1|  593|Drosophila melanogaster IP10742p
           protein.
          Length = 593

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 47  SRHDV--FLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQG 220
           S+H +  +++A + + V++   T+G +     D    +++++ E+ +      S    QG
Sbjct: 196 SQHSLTEYIDAHNAY-VQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQG 254

Query: 221 APQSSGKSHDEPRRHQN 271
           A   +GK++D+ +R+ +
Sbjct: 255 AEVIAGKANDQAKRYNS 271


>AY752601-1|AAW32047.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY752599-1|AAW32045.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY752598-1|AAW32044.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY752597-1|AAW32043.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY752595-1|AAW32041.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY752594-1|AAW32040.1|  233|Drosophila melanogaster CG13732
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AY150712-1|AAN78362.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150711-1|AAN78361.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150709-1|AAN78359.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150708-1|AAN78358.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150707-1|AAN78357.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150705-1|AAN78355.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150704-1|AAN78354.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150703-1|AAN78353.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150702-1|AAN78352.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY150701-1|AAN78351.1|  210|Drosophila melanogaster CG13732 protein
           protein.
          Length = 210

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 12  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 58


>AY118419-1|AAM48448.1|  167|Drosophila melanogaster RE73934p
           protein.
          Length = 167

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFE--LQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           T D KI+ L+  + +  I  +    LQH KT+  + Q + G   S  K + + R++
Sbjct: 87  TVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKY 142


>AY071054-1|AAL48676.1|  279|Drosophila melanogaster RE13914p
           protein.
          Length = 279

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +2

Query: 209 KAQGAPQSSGKSHDEPRRHQNQRQSEKSA 295
           KA G   S GK H + RR + Q+Q +K A
Sbjct: 247 KANGN-SSGGKQHGQSRRTKEQKQKDKGA 274


>AY069384-1|AAL39529.1|  469|Drosophila melanogaster LD09414p
           protein.
          Length = 469

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -1

Query: 245 EISQMTEELLALFEPRETWFSDAEVQTSVQSYCVYYPGEGRLFSHL 108
           EI +  E LL LF P E   +     T+++  C++   + + F++L
Sbjct: 179 EILEPKELLLELFPPIEAESTTTRETTNLERICIFIGADNQRFANL 224


>AJ276419-1|CAC08819.1|  167|Drosophila melanogaster TBP associated
           factor TAFII24 protein.
          Length = 167

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFE--LQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           T D KI+ L+  + +  I  +    LQH KT+  + Q + G   S  K + + R++
Sbjct: 87  TVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKY 142


>AJ243836-1|CAB55760.2|  167|Drosophila melanogaster TATA binding
           protein asssociatedfactor 24kDa subunit, (dTAFII24
           protein) protein.
          Length = 167

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFE--LQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           T D KI+ L+  + +  I  +    LQH KT+  + Q + G   S  K + + R++
Sbjct: 87  TVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKY 142


>AF215688-1|AAF22851.1|  279|Drosophila melanogaster Miple2 protein.
          Length = 279

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +2

Query: 209 KAQGAPQSSGKSHDEPRRHQNQRQSEKSA 295
           KA G   S GK H + RR + Q+Q +K A
Sbjct: 247 KANGN-SSGGKQHGQSRRTKEQKQKDKGA 274


>AE014297-1917|AAF55111.1|  469|Drosophila melanogaster CG7265-PA
           protein.
          Length = 469

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -1

Query: 245 EISQMTEELLALFEPRETWFSDAEVQTSVQSYCVYYPGEGRLFSHL 108
           EI +  E LL LF P E   +     T+++  C++   + + F++L
Sbjct: 179 EILEPKELLLELFPPIEAESTTTRETTNLERICIFIGADNQRFANL 224


>AE014296-2917|AAF49334.2|  233|Drosophila melanogaster CG13732-PA
           protein.
          Length = 233

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +2

Query: 113 GKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           GKI  LL  +    +E    + H+K K  S  KA    ++S  + +E
Sbjct: 35  GKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81


>AE014296-71|AAF47369.1|  279|Drosophila melanogaster CG18321-PA
           protein.
          Length = 279

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +2

Query: 209 KAQGAPQSSGKSHDEPRRHQNQRQSEKSA 295
           KA G   S GK H + RR + Q+Q +K A
Sbjct: 247 KANGN-SSGGKQHGQSRRTKEQKQKDKGA 274


>AE014134-466|AAF51210.1|  167|Drosophila melanogaster CG2859-PA
           protein.
          Length = 167

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFE--LQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           T D KI+ L+  + +  I  +    LQH KT+  + Q + G   S  K + + R++
Sbjct: 87  TVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKY 142


>AE013599-2057|AAF58137.1|  390|Drosophila melanogaster CG12958-PA
           protein.
          Length = 390

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 47  SRHDV--FLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQG 220
           S+H +  +++A + + V++   T+G +     D    +++++ E+ +      S    QG
Sbjct: 161 SQHSLTEYIDAHNAY-VQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQG 219

Query: 221 APQSSGKSHDEPRRHQN 271
           A   +GK++D+ +R+ +
Sbjct: 220 AEVIAGKANDQAKRYNS 236


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,607,092
Number of Sequences: 53049
Number of extensions: 315108
Number of successful extensions: 1229
Number of sequences better than 10.0: 56
Number of HSP's better than 10.0 without gapping: 1190
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1229
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1086986940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).