SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04132-4|CAA27750.1| 1237|Drosophila melanogaster protein ( Dros...    85   1e-16
AY928609-2|AAX28841.1| 1000|Drosophila melanogaster RNA-dependen...    85   1e-16
AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.      85   1e-16
AY095181-1|AAM12274.1|  320|Drosophila melanogaster GM07634p pro...    85   1e-16
S68526-1|AAD14015.2|  624|Drosophila melanogaster pol polyprotei...    80   3e-15
AY089684-1|AAL90422.1|  370|Drosophila melanogaster RH61266p pro...    76   7e-14
AF541949-2|AAN34652.1|  826|Drosophila melanogaster pol protein ...    76   7e-14
AF420242-1|AAL16060.1|  826|Drosophila melanogaster RNA-directed...    76   7e-14
AY089271-1|AAL90009.1|  451|Drosophila melanogaster AT07338p pro...    70   3e-12
AF365402-2|AAK53386.1| 1059|Drosophila melanogaster reverse tran...    59   6e-09
Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia poly...    58   1e-08
AY050234-1|AAK84933.1| 1026|Drosophila melanogaster SD02026p pro...    56   4e-08
AY928610-2|AAX28844.1| 1088|Drosophila melanogaster reverse tran...    55   1e-07
M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protei...    53   4e-07
EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein ...    53   4e-07
DQ887187-2|ABI48306.1| 1010|Drosophila melanogaster pol protein ...    53   4e-07
DQ887186-2|ABI48303.1| 1010|Drosophila melanogaster pol protein ...    53   4e-07
AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol pr...    53   4e-07
AF222049-2|AAF36671.1| 1037|Drosophila melanogaster pol protein ...    52   1e-06
EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein ...    51   2e-06
AJ000387-3|CAA04050.1| 1217|Drosophila melanogaster reverse tran...    50   3e-06
X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D. m...    50   5e-06
X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein.         49   9e-06
U89994-2|AAB50148.1| 1041|Drosophila melanogaster reverse transc...    49   9e-06
AF364549-2|AAK52055.1| 1013|Drosophila melanogaster RNA-directed...    44   3e-04
X15707-1|CAA33737.1|  267|Drosophila melanogaster protein ( Dros...    39   0.007
AJ279888-1|CAB69645.1|  120|Drosophila melanogaster integrase pr...    37   0.029
AY180918-2|AAN87271.1| 1003|Drosophila melanogaster ORF2 protein.      35   0.12 
AY058502-1|AAL13731.1|  280|Drosophila melanogaster LD21171p pro...    35   0.12 
AF541948-2|AAN34651.1| 1006|Drosophila melanogaster pol protein ...    33   0.36 
AY071594-1|AAL49216.1|  698|Drosophila melanogaster RE64386p pro...    33   0.63 
AE014296-2629|AAF49543.2|  698|Drosophila melanogaster CG5235-PA...    33   0.63 
AE014134-301|AAX52653.1|  386|Drosophila melanogaster CG31931-PA...    32   1.1  
AE014296-1323|AAN12020.1|  294|Drosophila melanogaster CG32371-P...    31   1.9  
AY070709-1|AAL48180.1|  652|Drosophila melanogaster SD02261p pro...    31   2.5  
AE014296-3203|AAF49118.1|  652|Drosophila melanogaster CG8743-PA...    31   2.5  
X04456-2|CAD27357.1| 1017|Drosophila melanogaster hypothetical p...    30   3.3  
X04456-1|CAA28054.2| 1409|Drosophila melanogaster hypothetical p...    30   3.3  
X02600-1|CAA26447.1| 1288|Drosophila melanogaster protein ( Dros...    30   3.3  
X02599-1|CAA26444.1| 1409|Drosophila melanogaster 31 KD polyprot...    30   3.3  
BT014672-1|AAT27296.1|  294|Drosophila melanogaster AT13084p pro...    30   3.3  
BT011428-1|AAR99086.1| 1409|Drosophila melanogaster SD14423p pro...    30   3.3  
X01472-2|CAA25702.1| 1058|Drosophila melanogaster protein ( Dros...    29   5.8  

>X04132-4|CAA27750.1| 1237|Drosophila melanogaster protein (
            Drosophila retrotransposon412 genome. ).
          Length = 1237

 Score = 85.0 bits (201), Expect = 1e-16
 Identities = 44/139 (31%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  ITD G  + + ++  L +   IK+I ++ +H QT G +ERSH TL EY+RSYI 
Sbjct: 1023 GPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSYIS 1082

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL----DLNTYSDYI 476
             ++  WD++L+  +  +N+       + P EL+FG    +PK  + L     +    DY 
Sbjct: 1083 TDKTDWDVWLQYFVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNIDDYA 1142

Query: 475  RALNHRLYYSRQKALQNIE 419
            +   +RL  +  +A + +E
Sbjct: 1143 KESKYRLEVAYARARKLLE 1161


>AY928609-2|AAX28841.1| 1000|Drosophila melanogaster RNA-dependent DNA
            polymerase protein.
          Length = 1000

 Score = 85.0 bits (201), Expect = 1e-16
 Identities = 44/139 (31%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  ITD G  + + ++  L +   IK+I ++ +H QT G +ERSH TL EY+RSYI 
Sbjct: 786  GPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSYIS 845

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL----DLNTYSDYI 476
             ++  WD++L+  +  +N+       + P EL+FG    +PK  + L     +    DY 
Sbjct: 846  TDKTDWDVWLQYFVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNIDDYA 905

Query: 475  RALNHRLYYSRQKALQNIE 419
            +   +RL  +  +A + +E
Sbjct: 906  KESKYRLEVAYARARKLLE 924


>AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.
          Length = 994

 Score = 85.0 bits (201), Expect = 1e-16
 Identities = 48/139 (34%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  ITDQG  + + +M +L +   I+++ +S +H QT G +ERSH T  EY+RSYI 
Sbjct: 781  GPMKTFITDQGTEYKNSLMNELCKYMHIENLTSSAHHHQTLGTIERSHRTFNEYIRSYIS 840

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPK---SIDSLD-LNTYSDYI 476
             N+  WD++L      +N+       + P EL+FG  P   K    I+ +D +    DY 
Sbjct: 841  VNKSDWDIWLPYFTYCFNTTPSIVHDYCPYELVFGRLPRQFKDFSKINKIDPIYNLDDYS 900

Query: 475  RALNHRLYYSRQKALQNIE 419
            + L  RL  S  +A + +E
Sbjct: 901  KELKCRLELSYNRARRMLE 919


>AY095181-1|AAM12274.1|  320|Drosophila melanogaster GM07634p
           protein.
          Length = 320

 Score = 85.0 bits (201), Expect = 1e-16
 Identities = 44/139 (31%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G  K  ITD G  + + ++  L +   IK+I ++ +H QT G +ERSH TL EY+RSYI 
Sbjct: 174 GPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSYIS 233

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL----DLNTYSDYI 476
            ++  WD++L+  +  +N+       + P EL+FG    +PK  + L     +    DY 
Sbjct: 234 TDKTDWDVWLQYFVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNIDDYA 293

Query: 475 RALNHRLYYSRQKALQNIE 419
           +   +RL  +  +A + +E
Sbjct: 294 KESKYRLEVAYARARKLLE 312


>S68526-1|AAD14015.2|  624|Drosophila melanogaster pol polyprotein
           protein.
          Length = 624

 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 4/134 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G  K IITD G  + ++++  L +   IK+I ++ +H QT G +ERSH T  EY+RSYI 
Sbjct: 410 GPMKTIITDMGTEYKNQIIDDLCKYMKIKNITSTAHHHQTLGTIERSHRTFNEYVRSYIS 469

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP--YIP-KSIDSLD-LNTYSDYI 476
            ++  WD++++     +N+       + P EL+FG  P  +I    ID +D +    DY 
Sbjct: 470 VDKTDWDIWIQYFTYCFNTTPSVVHDYCPYELVFGRLPRQFIDFNRIDRIDPIYNMDDYS 529

Query: 475 RALNHRLYYSRQKA 434
           + +  RL  + ++A
Sbjct: 530 KEVKLRLEIAYRRA 543


>AY089684-1|AAL90422.1|  370|Drosophila melanogaster RH61266p
           protein.
          Length = 370

 Score = 75.8 bits (178), Expect = 7e-14
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 4/134 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G  K  I+D G  + + V++ + +   I+++ ++ YH QT G +ERSH T  EY+RSYI 
Sbjct: 156 GPMKTFISDMGTEYKNNVIQDMCKYMKIENLTSTAYHHQTLGTIERSHRTFNEYIRSYIS 215

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD----LNTYSDYI 476
            ++  WD++++     +N+       + P EL+FG  P    + +  D    L    DY 
Sbjct: 216 ADKTDWDVWIQYFTYCFNTTPSVMHNYCPYELVFGRLPRQFANFNKADRIEPLYNIEDYS 275

Query: 475 RALNHRLYYSRQKA 434
           + +  RL  + ++A
Sbjct: 276 KEIKFRLEIAYKRA 289


>AF541949-2|AAN34652.1|  826|Drosophila melanogaster pol protein
            protein.
          Length = 826

 Score = 75.8 bits (178), Expect = 7e-14
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 4/134 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  I+D G  + + V++ + +   I+++ ++ YH QT G +ERSH T  EY+RSYI 
Sbjct: 612  GPMKTFISDMGTEYKNNVIQDMCKYMKIENLTSTAYHHQTLGTIERSHRTFNEYIRSYIS 671

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD----LNTYSDYI 476
             ++  WD++++     +N+       + P EL+FG  P    + +  D    L    DY 
Sbjct: 672  ADKTDWDVWIQYFTYCFNTTPSVMHNYCPYELVFGRLPRQFANFNKTDRIEPLYNIEDYS 731

Query: 475  RALNHRLYYSRQKA 434
            + +  RL  + ++A
Sbjct: 732  KEIKFRLEIAYKRA 745


>AF420242-1|AAL16060.1|  826|Drosophila melanogaster RNA-directed DNA
            polymerase protein.
          Length = 826

 Score = 75.8 bits (178), Expect = 7e-14
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 4/134 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G  K  I+D G  + + V++ + +   I+++ ++ YH QT G +ERSH T  EY+RSYI 
Sbjct: 612  GPMKTFISDMGTEYKNNVIQDMCKYMKIENLTSTAYHHQTLGTIERSHRTFNEYIRSYIS 671

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLD----LNTYSDYI 476
             ++  WD++++     +N+       + P EL+FG  P    + +  D    L    DY 
Sbjct: 672  ADKTDWDVWIQYFTYCFNTTPSVMHNYCPYELVFGRLPRQFANFNKTDRIEPLYNIEDYS 731

Query: 475  RALNHRLYYSRQKA 434
            + +  RL  + ++A
Sbjct: 732  KEIKFRLEIAYKRA 745


>AY089271-1|AAL90009.1|  451|Drosophila melanogaster AT07338p
           protein.
          Length = 451

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 31/104 (29%), Positives = 56/104 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK++ITD     +    ++     G++H   +PY PQ     ER++ T+K  +  +  
Sbjct: 220 GVPKVMITDNNVQLTIRAFRKFLEELGVRHQLTAPYTPQE-NPTERANRTVKTMIAQFTG 278

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            +Q TWD +     LA N+++  TTG+SP  +  G +P +P ++
Sbjct: 279 ADQRTWDEHWPELQLAVNTSVAETTGYSPAFITQGREPRLPNAL 322


>AF365402-2|AAK53386.1| 1059|Drosophila melanogaster reverse
            transcriptase-like polymeraseprotein.
          Length = 1059

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMK-QLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            G+PK+I+ D   + +S  +K  L    GI+   A PY     G +ER HSTL E +R   
Sbjct: 871  GVPKLIVMDNEKSLNSASIKFMLTDQLGIELYKAPPYKSTVNGQIERFHSTLSEIMRCLK 930

Query: 646  VENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             +  H  ++  L  A+  YN  +HS T   PLE+ FG
Sbjct: 931  GDGTHRGFEELLDRAIYEYNYTVHSVTKKRPLEVFFG 967


>Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia
            polyprotein protein.
          Length = 1333

 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 35/135 (25%), Positives = 60/135 (44%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   +Q      ++H+  +    +  G +ER +  +   +     
Sbjct: 1095 GFPKRIVSDKGTAFTSGAFEQFMSSHNVEHVCTTTGVARGNGQIERVNRLILAIISKLSS 1154

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            +    W  Y+     A N ++HS+   SP E++FG K Y       L+L    + +   N
Sbjct: 1155 DEPSKWYKYVPEVQKAINCHVHSSLKLSPFEVMFGTKMYTRVEDRLLEL-LQEEVVCQFN 1213

Query: 463  HRLYYSRQKALQNIE 419
               Y  RQ   +NIE
Sbjct: 1214 EDRYEMRQLVKRNIE 1228


>AY050234-1|AAK84933.1| 1026|Drosophila melanogaster SD02026p protein.
          Length = 1026

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 35/135 (25%), Positives = 59/135 (43%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I++D+G  F+S   +Q      ++H+  +    +  G +ER +      +     
Sbjct: 788  GFPKRIVSDKGTAFTSGAFEQFMSSHNVEHVCTTTGVARGNGQIERVNRLNLAIISKLSS 847

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            +    W  Y+     A N ++HS+   SP E++FG K Y       L+L    + +   N
Sbjct: 848  DEPSKWYKYVPEVQKAINCHVHSSLKLSPFEVMFGTKMYTRVEDRLLEL-LQEEVVCQFN 906

Query: 463  HRLYYSRQKALQNIE 419
               Y  RQ   +NIE
Sbjct: 907  EDRYEMRQLVKRNIE 921


>AY928610-2|AAX28844.1| 1088|Drosophila melanogaster reverse
            transcriptase protein.
          Length = 1088

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 41/125 (32%), Positives = 59/125 (47%), Gaps = 5/125 (4%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI- 647
            GIPK +I DQGA F+S++  +    F I     S     +   +ER HSTL E  R  + 
Sbjct: 867  GIPKKLIYDQGAEFASDMFNKFCTQFNIDLHVTSFQQSSSNSPVERLHSTLTEIYRIILD 926

Query: 646  VENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDY 479
            V  Q       D  +   ++ YN+ IHS T  +P E LF  + +I     ++  N   DY
Sbjct: 927  VRKQQKLSSEHDEIMSETLITYNNAIHSATKHTPFE-LFNGRTHIFN--QTIQFNNEHDY 983

Query: 478  IRALN 464
            +  LN
Sbjct: 984  LTKLN 988


>M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protein
            protein.
          Length = 1010

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 836  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 895

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 896  KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 927


>EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein
            protein.
          Length = 1045

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 871  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 930

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 931  KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 962


>DQ887187-2|ABI48306.1| 1010|Drosophila melanogaster pol protein
            protein.
          Length = 1010

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 836  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 895

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 896  KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 927


>DQ887186-2|ABI48303.1| 1010|Drosophila melanogaster pol protein
            protein.
          Length = 1010

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 836  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 895

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 896  KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 927


>AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol
            protein.
          Length = 1463

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 1289 KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 1348

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 1349 KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 1380


>AF222049-2|AAF36671.1| 1037|Drosophila melanogaster pol protein
            protein.
          Length = 1037

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +G PK I+TD    F   V+KQ      I   F +PY       +ER H TL E++R Y 
Sbjct: 851  LGKPKKIVTDN--EFDIVVIKQFLLENNIDIHFTTPYKKTGNSDVERLHLTLNEHMRLYN 908

Query: 646  VE--NQHTWDLYLRTAMLAYNSNIHSTTGFSPLEL 548
             +  N  T    +  A++ YN+ IHSTT   P++L
Sbjct: 909  ADPNNFDTIQENVYKAIVCYNNTIHSTTNIRPIDL 943


>EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein
            protein.
          Length = 1045

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E      ++ 
Sbjct: 871  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAEIASCLKLDK 930

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +   T +L LR A + YN  +HS T   P+E++
Sbjct: 931  KTNDTVELILR-ATIEYNKTVHSVTRERPIEVV 962


>AJ000387-3|CAA04050.1| 1217|Drosophila melanogaster reverse
            transcriptase protein.
          Length = 1217

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI- 647
            G+PK +I DQG  F +++ ++    + I     S     +   +ER HS+L E  R  + 
Sbjct: 978  GLPKKLIHDQGVEFCNDIFRKFCSQYNILLHVTSFQQSSSNSPVERLHSSLTEIYRIILD 1037

Query: 646  VENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDY 479
               +H      +  +   ++ YN+ IHSTT  +P EL  G      K+I   + + Y + 
Sbjct: 1038 TRKKHKLPTDHEEIMSETVITYNNAIHSTTKHTPFELFNGRTHLFEKTIIPNNEHDYLNK 1097

Query: 478  IRALNHRLY 452
            +     +LY
Sbjct: 1098 LNTFQDKLY 1106


>X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D.
            melanogaster retrotransposongypsy gene fragment for
            reverse transcriptase-like enzyme.).
          Length = 930

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 32/85 (37%), Positives = 44/85 (51%), Gaps = 3/85 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E  R   ++ 
Sbjct: 841  KTVYCDNEPAFNSETVTSMLKNTFGIDIVNAPPLHSSSNGQVERFHSTLAEIARCLKLDK 900

Query: 637  Q--HTWDLYLRTAMLAYNSNIHSTT 569
            +   T +L LR A + YN  +HS T
Sbjct: 901  KTSDTVELILR-ATIEYNKTVHSVT 924


>X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein.
          Length = 1494

 Score = 48.8 bits (111), Expect = 9e-06
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 1/96 (1%)
 Frame = -1

Query: 817  PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            PK II+D+GA F+S       +   +KHI  +   PQ  G +ER + +L   +   I  +
Sbjct: 1326 PKCIISDRGACFTSGDFDSFLKECNVKHIKIATGSPQANGQVERINRSLGPMISKLIEPD 1385

Query: 637  QHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            Q   WDL L       N+ +H +    P  +LFG +
Sbjct: 1386 QGLHWDLVLEKVEYTLNNTLHRSIKQYPSIMLFGLQ 1421


>U89994-2|AAB50148.1| 1041|Drosophila melanogaster reverse
            transcriptase polyprotein protein.
          Length = 1041

 Score = 48.8 bits (111), Expect = 9e-06
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 3/104 (2%)
 Frame = -1

Query: 814  KIIITDQGANFSSEVMKQL-ERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K I  D   + +SE +K L +  F +    A P H  + G +ER HSTL E  R   +++
Sbjct: 867  KTIFCDNEPSINSESIKSLLKNRFNVDIANAPPLHSTSNGQVERFHSTLLEIARCLKLDS 926

Query: 637  --QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
                T +L L+ A + YN  +HS T   P++++    P +   I
Sbjct: 927  GMNDTVNLILQ-ATIEYNKTVHSVTNRRPIDIIHSTPPELANEI 969


>AF364549-2|AAK52055.1| 1013|Drosophila melanogaster RNA-directed DNA
            polymerase protein.
          Length = 1013

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 3/93 (3%)
 Frame = -1

Query: 814  KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            K I  D   +  S+ ++  LE  FG+    A P H  + G +ER HSTL E  R   ++ 
Sbjct: 839  KTIYCDNEPSLKSQTIVAMLENHFGVSISNAPPLHSVSNGQVERFHSTLIELARCLKIDK 898

Query: 637  --QHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
                T +L L  A   YN +IHS     P E++
Sbjct: 899  GISDTVELVL-LATARYNMSIHSVINKKPAEVM 930


>X15707-1|CAA33737.1|  267|Drosophila melanogaster protein (
           Drosophila melanogasterDNA sequence (isolate CBS) for
           18S rRNA  (3'end), 5.8SrRNA and 28S rRNA (5'end).  ).
          Length = 267

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 2/84 (2%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMK-QLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           +++  D   + +S  +   L+  FG+    A P H  + G +ER HSTL E  R   ++ 
Sbjct: 117 RVVYCDNEPSLNSHTISTMLDNHFGVSIANAPPLHSVSNGQVERFHSTLLELARCLKIDK 176

Query: 637 QHTWDL-YLRTAMLAYNSNIHSTT 569
             T  +  +  A   YN +IHS T
Sbjct: 177 GITDTVEIILLATAKYNESIHSLT 200


>AJ279888-1|CAB69645.1|  120|Drosophila melanogaster integrase
           protein.
          Length = 120

 Score = 37.1 bits (82), Expect = 0.029
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = -1

Query: 814 KIIITDQGANFSSE-VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKE 665
           K +  D    F+SE V   L+  FGI  + A P H  + G +ER HSTL E
Sbjct: 68  KTVYCDNEPAFNSETVTSMLKNSFGIDIVNAPPLHSSSNGQVERFHSTLAE 118


>AY180918-2|AAN87271.1| 1003|Drosophila melanogaster ORF2 protein.
          Length = 1003

 Score = 35.1 bits (77), Expect = 0.12
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = -1

Query: 817  PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            PK++++D         +    R   I   +A     +  G +ER HST  E  R    E 
Sbjct: 815  PKVLVSDNERGLLCPTVLNYLRSLDIDLYYAPTQKSEVNGQVERFHSTFLEIYRCLKDEL 874

Query: 637  QHTWDLYL-RTAMLAYNSNIHSTTGFSPLELLF 542
                 + L   A+  YN+++HS T   P ++ F
Sbjct: 875  PTFKPVELVHIAVDRYNTSVHSVTNRKPADVFF 907


>AY058502-1|AAL13731.1|  280|Drosophila melanogaster LD21171p
           protein.
          Length = 280

 Score = 35.1 bits (77), Expect = 0.12
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           PK++++D         +    R   I   +A     +  G +ER HST  E  R    E 
Sbjct: 92  PKVLVSDNERGLLCPTVLNYLRSLDIDLYYAPTQKSEVNGQVERFHSTFLEIYRCLKDEL 151

Query: 637 QHTWDLYL-RTAMLAYNSNIHSTTGFSPLELLF 542
                + L   A+  YN+++HS T   P ++ F
Sbjct: 152 PTFKPVELVHIAVDRYNTSVHSVTNRKPADVFF 184


>AF541948-2|AAN34651.1| 1006|Drosophila melanogaster pol protein
            protein.
          Length = 1006

 Score = 33.5 bits (73), Expect = 0.36
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSY- 650
            +G PK++  D+   FSS  +K+     G++    +         +ER H T+ E +R   
Sbjct: 817  LGKPKLLKADRDGAFSSLALKEWLETEGVELQLNTT--KTGVADIERFHKTINEKIRIIN 874

Query: 649  IVENQHTWDLYLRTAMLAYNSNI-HSTTGFSPLEL-LFGFKP 530
             ++N  T    + T +  YN    H TTG +P  + L+  +P
Sbjct: 875  TMKNTETDLSKIETILYTYNHKTKHDTTGQTPAHIFLYAGQP 916


>AY071594-1|AAL49216.1|  698|Drosophila melanogaster RE64386p
           protein.
          Length = 698

 Score = 32.7 bits (71), Expect = 0.63
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 4/65 (6%)
 Frame = -1

Query: 763 QLERLFGIKHIFASPYHPQTCGALERS---HSTLKE-YLRSYIVENQHTWDLYLRTAMLA 596
           +L  L G +HI    Y P   G  ER+   H TL E   + Y   +  +WDL++R+A   
Sbjct: 238 RLPELTGKQHIIG--YEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTV 295

Query: 595 YNSNI 581
            NSN+
Sbjct: 296 CNSNL 300


>AE014296-2629|AAF49543.2|  698|Drosophila melanogaster CG5235-PA
           protein.
          Length = 698

 Score = 32.7 bits (71), Expect = 0.63
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 4/65 (6%)
 Frame = -1

Query: 763 QLERLFGIKHIFASPYHPQTCGALERS---HSTLKE-YLRSYIVENQHTWDLYLRTAMLA 596
           +L  L G +HI    Y P   G  ER+   H TL E   + Y   +  +WDL++R+A   
Sbjct: 238 RLPELTGKQHIIG--YEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTV 295

Query: 595 YNSNI 581
            NSN+
Sbjct: 296 CNSNL 300


>AE014134-301|AAX52653.1|  386|Drosophila melanogaster CG31931-PA
           protein.
          Length = 386

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 143 FVPSLLSDVWNVWLLIVACSVTSAACQ*TA 232
           F  SLL ++W+ WL I AC +T  A   TA
Sbjct: 288 FPNSLLINIWDFWLCIAACDLTEKAGDETA 317


>AE014296-1323|AAN12020.1|  294|Drosophila melanogaster CG32371-PA
           protein.
          Length = 294

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -2

Query: 270 AARVDLAHTEDPGAVH*QAAEVTEHATINSQTFHTSDSSEGT-KRFRRLPSFGFRLLQNR 94
           +A+ DLA TE    VH    + TE A+  ++   T   SEG+ +  R    +  R+ Q R
Sbjct: 199 SAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQER 258


>AY070709-1|AAL48180.1|  652|Drosophila melanogaster SD02261p
           protein.
          Length = 652

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = +1

Query: 145 RSFATVG-CVECLAVNSSVFCNFGGLSMNGSWIFCMCEVY 261
           RS AT   C+  L     +F  F  LS   +W++  C++Y
Sbjct: 510 RSLATTSECLFALINGDDMFATFATLSSKATWLWWFCQIY 549


>AE014296-3203|AAF49118.1|  652|Drosophila melanogaster CG8743-PA
           protein.
          Length = 652

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = +1

Query: 145 RSFATVG-CVECLAVNSSVFCNFGGLSMNGSWIFCMCEVY 261
           RS AT   C+  L     +F  F  LS   +W++  C++Y
Sbjct: 510 RSLATTSECLFALINGDDMFATFATLSSKATWLWWFCQIY 549


>X04456-2|CAD27357.1| 1017|Drosophila melanogaster hypothetical
           protein protein.
          Length = 1017

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE---NQHT 629
           D G  + S  M+Q     GI +    P+ PQ  G  ER   T+ E  R+ +     ++  
Sbjct: 158 DNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSF 217

Query: 628 WDLYLRTAMLAYN---SNIHSTTGFSPLELLFGFKPYI 524
           W   + TA    N   S     +  +P E+    KPY+
Sbjct: 218 WGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYL 255


>X04456-1|CAA28054.2| 1409|Drosophila melanogaster hypothetical
           protein protein.
          Length = 1409

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE---NQHT 629
           D G  + S  M+Q     GI +    P+ PQ  G  ER   T+ E  R+ +     ++  
Sbjct: 550 DNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSF 609

Query: 628 WDLYLRTAMLAYN---SNIHSTTGFSPLELLFGFKPYI 524
           W   + TA    N   S     +  +P E+    KPY+
Sbjct: 610 WGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYL 647


>X02600-1|CAA26447.1| 1288|Drosophila melanogaster protein (
           Drosophila melanogastervirus like particle RNA (VLP
           H-RNA). ).
          Length = 1288

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE---NQHT 629
           D G  + S  M+Q     GI +    P+ PQ  G  ER   T+ E  R+ +     ++  
Sbjct: 550 DNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSF 609

Query: 628 WDLYLRTAMLAYN---SNIHSTTGFSPLELLFGFKPYI 524
           W   + TA    N   S     +  +P E+    KPY+
Sbjct: 610 WGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYL 647


>X02599-1|CAA26444.1| 1409|Drosophila melanogaster 31 KD polyprotein
           protein.
          Length = 1409

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE---NQHT 629
           D G  + S  M+Q     GI +    P+ PQ  G  ER   T+ E  R+ +     ++  
Sbjct: 550 DNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSF 609

Query: 628 WDLYLRTAMLAYN---SNIHSTTGFSPLELLFGFKPYI 524
           W   + TA    N   S     +  +P E+    KPY+
Sbjct: 610 WGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYL 647


>BT014672-1|AAT27296.1|  294|Drosophila melanogaster AT13084p
           protein.
          Length = 294

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -2

Query: 270 AARVDLAHTEDPGAVH*QAAEVTEHATINSQTFHTSDSSEGT-KRFRRLPSFGFRLLQNR 94
           +A+ D+A TE    VH    + TE A+  ++   T   SEG+ +  R    +  R+ Q R
Sbjct: 199 SAQTDMAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQER 258


>BT011428-1|AAR99086.1| 1409|Drosophila melanogaster SD14423p
           protein.
          Length = 1409

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE---NQHT 629
           D G  + S  M+Q     GI +    P+ PQ  G  ER   T+ E  R+ +     ++  
Sbjct: 550 DNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSF 609

Query: 628 WDLYLRTAMLAYN---SNIHSTTGFSPLELLFGFKPYI 524
           W   + TA    N   S     +  +P E+    KPY+
Sbjct: 610 WGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYL 647


>X01472-2|CAA25702.1| 1058|Drosophila melanogaster protein (
            Drosophila melanogastercopia-like element 17.6. ).
          Length = 1058

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 4/105 (3%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGA-LERSHSTLKEYLRSY 650
            +G PK++  D+   FSS  +K   R    + +       +T  A +ER H T+ E +R  
Sbjct: 870  LGKPKLLKADRDGAFSSLALK---RWLESEEVELQLNTTKTGVADIERLHKTINEKIRII 926

Query: 649  -IVENQHTWDLYLRTAMLAYNSNI-HSTTGFSPLEL-LFGFKPYI 524
               +++ T    + T +  YN    H TTG +P  + L+  +P +
Sbjct: 927  KTSDDEETKLSKMETVLNIYNHKTKHDTTGQTPAHIFLYAGQPIL 971


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,296,426
Number of Sequences: 53049
Number of extensions: 667959
Number of successful extensions: 1815
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 1754
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1803
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3901127880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).