SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D49534-1|BAA08478.1| 1893|Drosophila melanogaster cno protein.         50   3e-06
AY058547-1|AAL13776.1| 2051|Drosophila melanogaster LD24616p pro...    50   3e-06
AE014297-185|AAF52067.2| 2051|Drosophila melanogaster CG2534-PA,...    50   3e-06
AE014297-184|AAN13260.1| 1882|Drosophila melanogaster CG2534-PB,...    50   3e-06
AE013599-1079|AAF58804.2|  401|Drosophila melanogaster CG12906-P...    29   6.6  
U31351-1|AAB97618.1|  810|Drosophila melanogaster protein ( Dros...    29   8.8  
L27654-1|AAA69925.1|  192|Drosophila melanogaster phosphoglycero...    29   8.8  
BT021345-1|AAX33493.1| 1603|Drosophila melanogaster LP19469p pro...    29   8.8  
AY047501-1|AAK77233.1|  475|Drosophila melanogaster GH01161p pro...    29   8.8  
AF119793-1|AAD34345.1|  463|Drosophila melanogaster TNF-receptor...    29   8.8  
AF044287-1|AAC01743.1|  810|Drosophila melanogaster delta adapti...    29   8.8  
AE014298-1480|AAF46614.4| 1812|Drosophila melanogaster CG32677-P...    29   8.8  
AE014298-1139|AAF46338.1|  475|Drosophila melanogaster CG10961-P...    29   8.8  

>D49534-1|BAA08478.1| 1893|Drosophila melanogaster cno protein.
          Length = 1893

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 168 VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
           +P GL +F+ PLQ+ G+C LA QP ++G WTVYM
Sbjct: 788 IPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM 821



 Score = 35.9 bits (79), Expect = 0.058
 Identities = 13/25 (52%), Positives = 21/25 (84%)
 Frame = +1

Query: 295 PVPDRHILQLHKNANGMGLILVSAK 369
           P P+  +++LHKN+NGMGL +V++K
Sbjct: 837 PQPELQLIKLHKNSNGMGLSIVASK 861


>AY058547-1|AAL13776.1| 2051|Drosophila melanogaster LD24616p protein.
          Length = 2051

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
            +P GL +F+ PLQ+ G+C LA QP ++G WTVYM
Sbjct: 957  IPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM 990



 Score = 37.1 bits (82), Expect = 0.025
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +1

Query: 295  PVPDRHILQLHKNANGMGLILVSAK 369
            P P+  +++LHKN+NGMGL +V+AK
Sbjct: 1006 PQPELQLIKLHKNSNGMGLSIVAAK 1030


>AE014297-185|AAF52067.2| 2051|Drosophila melanogaster CG2534-PA,
            isoform A protein.
          Length = 2051

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
            +P GL +F+ PLQ+ G+C LA QP ++G WTVYM
Sbjct: 957  IPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM 990



 Score = 37.1 bits (82), Expect = 0.025
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +1

Query: 295  PVPDRHILQLHKNANGMGLILVSAK 369
            P P+  +++LHKN+NGMGL +V+AK
Sbjct: 1006 PQPELQLIKLHKNSNGMGLSIVAAK 1030


>AE014297-184|AAN13260.1| 1882|Drosophila melanogaster CG2534-PB,
           isoform B protein.
          Length = 1882

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 168 VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
           +P GL +F+ PLQ+ G+C LA QP ++G WTVYM
Sbjct: 788 IPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM 821



 Score = 37.1 bits (82), Expect = 0.025
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +1

Query: 295 PVPDRHILQLHKNANGMGLILVSAK 369
           P P+  +++LHKN+NGMGL +V+AK
Sbjct: 837 PQPELQLIKLHKNSNGMGLSIVAAK 861


>AE013599-1079|AAF58804.2|  401|Drosophila melanogaster CG12906-PA
           protein.
          Length = 401

 Score = 29.1 bits (62), Expect = 6.6
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = -2

Query: 502 FFFSRP*GLPLEPQSFIKLVIGIVIYIRLHIM 407
           +F  RP GL L+ + +IK+  G +  +R+H++
Sbjct: 146 YFAGRPSGLLLKCRYYIKITFGSITLLRIHLI 177


>U31351-1|AAB97618.1|  810|Drosophila melanogaster protein (
           Drosophila melanogastergarnet mRNA, complete cds. ).
          Length = 810

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +1

Query: 643 ISLCIPVCMYVSRMYIGMYVCLSYVYRYVC 732
           +S+ I + +  + +YI +Y+C  Y YR  C
Sbjct: 103 MSIAISLIVIATTIYIYIYICYRYCYRCCC 132


>L27654-1|AAA69925.1|  192|Drosophila melanogaster
           phosphoglyceromutase protein.
          Length = 192

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 4/60 (6%)
 Frame = -2

Query: 241 CGW----CASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNP 74
           CGW     + +   +R +G      PG     HL A P PGD  +G  P A     + NP
Sbjct: 16  CGWYDANLSEKGGSSRAQGR-QGCRPGVRCGPHLGANPRPGD--AGQHPEASGHKEIPNP 72


>BT021345-1|AAX33493.1| 1603|Drosophila melanogaster LP19469p
           protein.
          Length = 1603

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +1

Query: 205 SGRGCVCSHTSRTRSARGPCTWAERPRLPPPVPDR 309
           +G G + + + +TRSA   C+ +    +PPP+P+R
Sbjct: 889 TGNG-IGNGSGKTRSAGSNCSSSANGGMPPPIPER 922


>AY047501-1|AAK77233.1|  475|Drosophila melanogaster GH01161p
           protein.
          Length = 475

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = -2

Query: 217 SPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTCIESL 56
           S A   GA+ + +P  + A +      PG   SG Q   LLDS  +   CI+ L
Sbjct: 58  SAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWL 111


>AF119793-1|AAD34345.1|  463|Drosophila melanogaster
           TNF-receptor-associated factor 2 protein.
          Length = 463

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = -2

Query: 217 SPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTCIESL 56
           S A   GA+ + +P  + A +      PG   SG Q   LLDS  +   CI+ L
Sbjct: 46  SAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWL 99


>AF044287-1|AAC01743.1|  810|Drosophila melanogaster delta adaptin
           subunit of AP-3 protein.
          Length = 810

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +1

Query: 643 ISLCIPVCMYVSRMYIGMYVCLSYVYRYVC 732
           +S+ I + +  + +YI +Y+C  Y YR  C
Sbjct: 103 MSIAISLIVIATTIYIYIYICYRYCYRCCC 132


>AE014298-1480|AAF46614.4| 1812|Drosophila melanogaster CG32677-PA
            protein.
          Length = 1812

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +1

Query: 205  SGRGCVCSHTSRTRSARGPCTWAERPRLPPPVPDR 309
            +G G + + + +TRSA   C+ +    +PPP+P+R
Sbjct: 1100 TGNG-IGNGSGKTRSAGSNCSSSANGGMPPPIPER 1133


>AE014298-1139|AAF46338.1|  475|Drosophila melanogaster CG10961-PA
           protein.
          Length = 475

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = -2

Query: 217 SPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTCIESL 56
           S A   GA+ + +P  + A +      PG   SG Q   LLDS  +   CI+ L
Sbjct: 58  SAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWL 111


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,618,882
Number of Sequences: 53049
Number of extensions: 710819
Number of successful extensions: 2558
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 2319
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2554
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3355404063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).