SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ302712-2|CAC16871.1| 1227|Drosophila melanogaster pol protein.       38   0.011
AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p pro...    34   0.18 
AM040243-1|CAJ13339.1|  656|Drosophila melanogaster pol protein ...    33   0.32 
AM040242-2|CAJ13338.1| 1103|Drosophila melanogaster pol protein ...    33   0.32 
AJ542582-2|CAD65871.1| 1103|Drosophila melanogaster pol protein ...    33   0.32 
AJ542581-2|CAD65869.1| 1103|Drosophila melanogaster pol protein ...    33   0.32 
M22874-2|AAA28675.1|  916|Drosophila melanogaster protein ( D.me...    29   9.0  
AE014134-2150|AAF53159.2|  270|Drosophila melanogaster CG14947-P...    29   9.0  

>AJ302712-2|CAC16871.1| 1227|Drosophila melanogaster pol protein.
          Length = 1227

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 51/229 (22%), Positives = 87/229 (37%), Gaps = 21/229 (9%)
 Frame = -3

Query: 635 KVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALR 459
           KVI     ++  +  R+ HK   PW   +++ L                + +L  YK   
Sbjct: 267 KVIRSAANYSIPQTKRVIHKAKVPWWNANLQQLRDQKQRLFSSYKANTNDTNLIRYKKAN 326

Query: 458 NRCNRLCRDAKRLYFHKSLENRSPAHT----WRFLKSV-GIGKTPVSSVKD-----TDLC 309
               +    AKR    K     SP  +    W  +K + GI  TP   +K      T   
Sbjct: 327 ALFKKAVLSAKRNSLEKFTSKISPVSSTKKVWSDIKRLAGIPPTPFKYIKSNSGTLTGSF 386

Query: 308 ALNKHFSLPPVSLS-DSSKTATLLKISS-LSVPRIPIFELSPVSVA--------DVRNSF 159
            + + F+L     S D + +A  +++ +   +    I  LSP + +        ++ NS 
Sbjct: 387 DIAEEFALSWSKYSSDQNFSAEYIRVKNRYLLEPYAIDSLSPSATSLDSNFTLLEIENSV 446

Query: 158 FSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                 + G D V   M+  + P +   L DIFN   T+  +P +W+ A
Sbjct: 447 AKAKGKSPGADRVSYPMLKNLSPHLKTKLLDIFNQILTTGKYPHTWRSA 495


>AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p
           protein.
          Length = 906

 Score = 34.3 bits (75), Expect = 0.18
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -3

Query: 236 ISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIF 60
           + SL  P      + P+ V ++  +  S+    + GIDNVC+  +  +       L  I+
Sbjct: 421 LDSLETPLQMSLPIKPIRVEEIVEAIKSLPLKKSPGIDNVCNATLKALPVRAILYLALIY 480

Query: 59  NFSFTSSNFPDSWKPAA 9
           N       FP  WK AA
Sbjct: 481 NAILRVQFFPKQWKMAA 497


>AM040243-1|CAJ13339.1|  656|Drosophila melanogaster pol protein
           protein.
          Length = 656

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 191 PVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI-LTDIFNFSFTSSNFPDSWK 18
           PV++A++     S+    A G DN+ +K I + LPT A I L  I+N    + +FP+ WK
Sbjct: 36  PVTLAELNGLINSLELKKAPGTDNLNNKTI-INLPTKARIYLILIYNNILRTGHFPNKWK 94

Query: 17  PAA 9
            A+
Sbjct: 95  HAS 97


>AM040242-2|CAJ13338.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 191 PVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI-LTDIFNFSFTSSNFPDSWK 18
           PV++A++     S+    A G DN+ +K I + LPT A I L  I+N    + +FP+ WK
Sbjct: 483 PVTLAELNGLINSLELKKAPGTDNLNNKTI-INLPTKARIYLILIYNNILRTGHFPNKWK 541

Query: 17  PAA 9
            A+
Sbjct: 542 HAS 544


>AJ542582-2|CAD65871.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 191 PVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI-LTDIFNFSFTSSNFPDSWK 18
           PV++A++     S+    A G DN+ +K I + LPT A I L  I+N    + +FP+ WK
Sbjct: 483 PVTLAELNGLINSLELKKAPGTDNLNNKTI-INLPTKARIYLILIYNNILRTGHFPNKWK 541

Query: 17  PAA 9
            A+
Sbjct: 542 HAS 544


>AJ542581-2|CAD65869.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 191 PVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI-LTDIFNFSFTSSNFPDSWK 18
           PV++A++     S+    A G DN+ +K I + LPT A I L  I+N    + +FP+ WK
Sbjct: 483 PVTLAELNGLINSLELKKAPGTDNLNNKTI-INLPTKARIYLILIYNNILRTGHFPNKWK 541

Query: 17  PAA 9
            A+
Sbjct: 542 HAS 544


>M22874-2|AAA28675.1|  916|Drosophila melanogaster protein (
           D.melanogaster LINEelement J-1, clone J-1. ).
          Length = 916

 Score = 28.7 bits (61), Expect = 9.0
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = -3

Query: 197 LSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           LS V++ +V+N    +    A G D + ++ I L+       L  IFN       FP +W
Sbjct: 435 LSAVTLEEVKNLIAKLPLKKAPGEDLLDNRTIRLLPDQALQFLALIFNSVLDVGYFPKAW 494

Query: 20  KPAA 9
           K A+
Sbjct: 495 KSAS 498


>AE014134-2150|AAF53159.2|  270|Drosophila melanogaster CG14947-PA
           protein.
          Length = 270

 Score = 28.7 bits (61), Expect = 9.0
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -3

Query: 326 KDTDLCALNKHFSLPPVSLSDSSKTATLLKIS 231
           K +D+C LN HF L  ++L D S   +  KIS
Sbjct: 79  KVSDVCLLNDHFILVKMALPDPSPPPSKSKIS 110


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,744,406
Number of Sequences: 53049
Number of extensions: 706207
Number of successful extensions: 1873
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1869
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3437745267
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).