SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L34276-1|AAA28694.1|  217|Drosophila melanogaster manganese supe...   305   5e-83
BT004505-1|AAO42669.1|  217|Drosophila melanogaster GH02759p pro...   305   5e-83
AE013599-2339|AAF57955.1|  217|Drosophila melanogaster CG8905-PA...   305   5e-83
L18947-1|AAA20533.1|  217|Drosophila melanogaster Mn-superoxide ...   304   9e-83
X64062-1|CAA45418.1|  143|Drosophila melanogaster superoxide dis...   209   3e-54

>L34276-1|AAA28694.1|  217|Drosophila melanogaster manganese
           superoxide dismutase protein.
          Length = 217

 Score =  305 bits (749), Expect = 5e-83
 Identities = 133/199 (66%), Positives = 164/199 (82%)
 Frame = +3

Query: 135 ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDT 314
           A R KHTLP+LPY+Y ALEP+I REIM LHH KHH TY+NNLN AEE+L +A++K D   
Sbjct: 14  AVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTK 73

Query: 315 IINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           +I LAPAL+FNGGGHINH+IFW NLSPN  +PSD L KA+E  + S +  K +L+T +VA
Sbjct: 74  LIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVA 133

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+  KLQ+A   NQDPL+A+TGL+PLFGIDVWEHAYYLQYKNVR  YV
Sbjct: 134 VQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYV 193

Query: 675 KAIFDVANWNDISQRYEKA 731
           +AI+D+ANW+DIS R+++A
Sbjct: 194 EAIWDIANWDDISCRFQEA 212


>BT004505-1|AAO42669.1|  217|Drosophila melanogaster GH02759p
           protein.
          Length = 217

 Score =  305 bits (749), Expect = 5e-83
 Identities = 133/199 (66%), Positives = 164/199 (82%)
 Frame = +3

Query: 135 ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDT 314
           A R KHTLP+LPY+Y ALEP+I REIM LHH KHH TY+NNLN AEE+L +A++K D   
Sbjct: 14  AVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTK 73

Query: 315 IINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           +I LAPAL+FNGGGHINH+IFW NLSPN  +PSD L KA+E  + S +  K +L+T +VA
Sbjct: 74  LIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVA 133

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+  KLQ+A   NQDPL+A+TGL+PLFGIDVWEHAYYLQYKNVR  YV
Sbjct: 134 VQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYV 193

Query: 675 KAIFDVANWNDISQRYEKA 731
           +AI+D+ANW+DIS R+++A
Sbjct: 194 EAIWDIANWDDISCRFQEA 212


>AE013599-2339|AAF57955.1|  217|Drosophila melanogaster CG8905-PA
           protein.
          Length = 217

 Score =  305 bits (749), Expect = 5e-83
 Identities = 133/199 (66%), Positives = 164/199 (82%)
 Frame = +3

Query: 135 ASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDT 314
           A R KHTLP+LPY+Y ALEP+I REIM LHH KHH TY+NNLN AEE+L +A++K D   
Sbjct: 14  AVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTK 73

Query: 315 IINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           +I LAPAL+FNGGGHINH+IFW NLSPN  +PSD L KA+E  + S +  K +L+T +VA
Sbjct: 74  LIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVA 133

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+  KLQ+A   NQDPL+A+TGL+PLFGIDVWEHAYYLQYKNVR  YV
Sbjct: 134 VQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYV 193

Query: 675 KAIFDVANWNDISQRYEKA 731
           +AI+D+ANW+DIS R+++A
Sbjct: 194 EAIWDIANWDDISCRFQEA 212


>L18947-1|AAA20533.1|  217|Drosophila melanogaster Mn-superoxide
           dismutase protein.
          Length = 217

 Score =  304 bits (747), Expect = 9e-83
 Identities = 132/197 (67%), Positives = 163/197 (82%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           R KHTLP+LPY+Y ALEP+I REIM LHH KHH TY+NNLN AEE+L +A++K D   +I
Sbjct: 16  RGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLI 75

Query: 321 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            LAPAL+FNGGGHINH+IFW NLSPN  +PSD L KA+E  + S +  K +L+T +VAVQ
Sbjct: 76  QLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQ 135

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           GSGWGWLG+NK+  KLQ+A   NQDPL+A+TGL+PLFGIDVWEHAYYLQYKNVR  YV+A
Sbjct: 136 GSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEA 195

Query: 681 IFDVANWNDISQRYEKA 731
           I+D+ANW+DIS R+++A
Sbjct: 196 IWDIANWDDISCRFQEA 212


>X64062-1|CAA45418.1|  143|Drosophila melanogaster superoxide
           dismutase (Mn type) protein.
          Length = 143

 Score =  209 bits (511), Expect = 3e-54
 Identities = 91/143 (63%), Positives = 114/143 (79%)
 Frame = +3

Query: 195 VISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSI 374
           +I REIM LHH KHH TY+NNLN AEE+L +A++K D   +I LAPAL+FNGGGHINH+I
Sbjct: 1   IICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQLAPALRFNGGGHINHTI 60

Query: 375 FWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQI 554
           FW NLSPN  +PSD L KA+E  + S +  K +++T +VAVQGSGWGWLG+NK+  KLQ+
Sbjct: 61  FWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKEVTTLTVAVQGSGWGWLGFNKKSGKLQL 120

Query: 555 ATCQNQDPLQATTGLVPLFGIDV 623
           A   NQDPL+A+TGL+PLFGIDV
Sbjct: 121 AALPNQDPLEASTGLIPLFGIDV 143


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,154,760
Number of Sequences: 53049
Number of extensions: 887367
Number of successful extensions: 2141
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2038
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2141
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4332305172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).