SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY122152-1|AAM52664.1|  121|Drosophila melanogaster LD05816p pro...   241   4e-64
AE014298-1489|AAF46617.1|  121|Drosophila melanogaster CG32672-P...   241   4e-64
AY069026-1|AAL39171.2|  158|Drosophila melanogaster AT01047p pro...   215   6e-56
AE014297-2401|AAF55459.1|  120|Drosophila melanogaster CG12334-P...   215   6e-56
AY240945-1|AAP69822.1|  949|Drosophila melanogaster G protein co...    30   3.1  
AE014298-2723|AAX52506.1|  991|Drosophila melanogaster CG32547-P...    30   3.1  
AY061603-1|AAL29151.1|  319|Drosophila melanogaster SD06362p pro...    28   9.4  
AE014298-2847|AAF48960.1|  323|Drosophila melanogaster CG12204-P...    28   9.4  

>AY122152-1|AAM52664.1|  121|Drosophila melanogaster LD05816p
           protein.
          Length = 121

 Score =  241 bits (591), Expect = 4e-64
 Identities = 109/116 (93%), Positives = 116/116 (100%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKEEH+FEKR+AEG+KIRRKYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHH+ED+FLYIA+SDENVYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116


>AE014298-1489|AAF46617.1|  121|Drosophila melanogaster CG32672-PA
           protein.
          Length = 121

 Score =  241 bits (591), Expect = 4e-64
 Identities = 109/116 (93%), Positives = 116/116 (100%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKEEH+FEKR+AEG+KIRRKYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHH+ED+FLYIA+SDENVYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116


>AY069026-1|AAL39171.2|  158|Drosophila melanogaster AT01047p
           protein.
          Length = 158

 Score =  215 bits (524), Expect = 6e-56
 Identities = 94/118 (79%), Positives = 112/118 (94%)
 Frame = +2

Query: 38  INMKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVG 217
           ++M +QYK++HSF+KR+ EG+KIRRKYPDRVPVIVEKAPK R  +LDKKKYLVP+DLTVG
Sbjct: 39  MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVG 98

Query: 218 QFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           QFYFLIRKRI+LRP+DALFFFVNNVIPPTSATMG+LYQEH D+D+FLYI+++DENVYG
Sbjct: 99  QFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 156


>AE014297-2401|AAF55459.1|  120|Drosophila melanogaster CG12334-PA
           protein.
          Length = 120

 Score =  215 bits (524), Expect = 6e-56
 Identities = 94/118 (79%), Positives = 112/118 (94%)
 Frame = +2

Query: 38  INMKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVG 217
           ++M +QYK++HSF+KR+ EG+KIRRKYPDRVPVIVEKAPK R  +LDKKKYLVP+DLTVG
Sbjct: 1   MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVG 60

Query: 218 QFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           QFYFLIRKRI+LRP+DALFFFVNNVIPPTSATMG+LYQEH D+D+FLYI+++DENVYG
Sbjct: 61  QFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118


>AY240945-1|AAP69822.1|  949|Drosophila melanogaster G protein
           coupled receptor protein.
          Length = 949

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +2

Query: 80  KRKAEGEKIRRKYPDRVPVIVEKAPKARLGD 172
           +R+ E EK+RR+ PD   +  +++PK + G+
Sbjct: 682 QREREREKVRRQLPDIEKLYAQRSPKGKRGE 712


>AE014298-2723|AAX52506.1|  991|Drosophila melanogaster CG32547-PA
           protein.
          Length = 991

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +2

Query: 80  KRKAEGEKIRRKYPDRVPVIVEKAPKARLGD 172
           +R+ E EK+RR+ PD   +  +++PK + G+
Sbjct: 724 QREREREKVRRQLPDIEKLYAQRSPKGKRGE 754


>AY061603-1|AAL29151.1|  319|Drosophila melanogaster SD06362p
           protein.
          Length = 319

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 2/59 (3%)
 Frame = -1

Query: 389 HRHFRRKMLCIKRNLHHGVLDRETPLLQMWVE*HCSRRRKV--RLQAAGEYVSGSRSRT 219
           HR  R+    +   LH  V  +   L + W + H  R  K   R +  G YV  S+ RT
Sbjct: 145 HRRHRKSKPTLNEELHQLVSLQMQALEKQWEQEHGGRHHKQVDRQEHRGRYVEQSQQRT 203


>AE014298-2847|AAF48960.1|  323|Drosophila melanogaster CG12204-PA
           protein.
          Length = 323

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 2/59 (3%)
 Frame = -1

Query: 389 HRHFRRKMLCIKRNLHHGVLDRETPLLQMWVE*HCSRRRKV--RLQAAGEYVSGSRSRT 219
           HR  R+    +   LH  V  +   L + W + H  R  K   R +  G YV  S+ RT
Sbjct: 149 HRRHRKSKPTLNEELHQLVSLQMQALEKQWEQEHGGRHHKQVDRQEHRGRYVEQSQQRT 207


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,873,574
Number of Sequences: 53049
Number of extensions: 556616
Number of successful extensions: 1281
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1281
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2724262200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).