SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-4030|AAF56644.2| 1958|Drosophila melanogaster CG5521-PA...   144   2e-34
U40214-1|AAA91230.1| 1768|Drosophila melanogaster parallel siste...    30   4.1  
BT023158-1|AAY55574.1|  342|Drosophila melanogaster IP09321p pro...    29   7.1  
AY084178-1|AAL89916.1|  601|Drosophila melanogaster RE52725p pro...    29   7.1  
AF000178-1|AAB58341.1|  598|Drosophila melanogaster M-spondin pr...    29   7.1  
AE014298-2005|AAF48347.1|  273|Drosophila melanogaster CG11585-P...    29   7.1  
AE014134-1266|AAF52507.1|  669|Drosophila melanogaster CG5155-PA...    29   7.1  
AE013599-1935|AAF58219.1|  601|Drosophila melanogaster CG10145-P...    29   7.1  

>AE014297-4030|AAF56644.2| 1958|Drosophila melanogaster CG5521-PA
            protein.
          Length = 1958

 Score =  144 bits (348), Expect = 2e-34
 Identities = 107/298 (35%), Positives = 155/298 (52%), Gaps = 26/298 (8%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRI--VEMYPGLAGKIIRWICACL 188
            PR+   +  LLQ L  K+  IA V  D + + A+   ++  +E  P L   II  IC  L
Sbjct: 1134 PRIKEVLQVLLQALQFKHHTIAIVAVDSLKLCAERGRQLAAIERVPQL---IITAICKAL 1190

Query: 189  AQLSTSCHRDTVKPLAGSLLLCLAEFAVRC-GPQYLMEEKDGEQTLLLLIFKVLYAVMKG 365
               S +  +D+ K +  SL+LCL EF +    P  L    +   TL+L + +VL  V  G
Sbjct: 1191 EIQSVTKPKDSDKVVLTSLMLCLGEFCMAIPAPIMLTPFNEQGDTLVLQVLRVLLQVASG 1250

Query: 366  ANGSDIEGLSLPVDDDFDPTIQLDNL-GPKTIPASTID-----------VKLWAQTICTQ 509
            A     E + L  DDDFD  I  D+L G   +P +T             +KL A+ +   
Sbjct: 1251 APRH--ERVKLTADDDFDMHIAHDDLQGDGRLPEATYQTSETIQKCITAIKLCAKAVSMH 1308

Query: 510  LVLYLGHWPLWSGC-QLSCRVSEQHD--SPSLGEELG--------PAVLTAPNIQLMRFS 656
            LV ++GH+P+  G  +LS  V EQ D  + + G ++         P+V++A N+QL   +
Sbjct: 1309 LVTHIGHFPMGIGASRLSSMVEEQDDIGNAAYGGQVETRRDSVELPSVVSAQNMQLFMLN 1368

Query: 657  DSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDPSGGQ 830
               +AS IELP L LP   G T GL T+++QVRVL+RD+ GKACWDAS LY +P   +
Sbjct: 1369 SGLVASFIELPTLKLPG-GGITAGLVTADKQVRVLMRDLNGKACWDASILYSEPRNAE 1425


>U40214-1|AAA91230.1| 1768|Drosophila melanogaster parallel sister
           chromatids protein protein.
          Length = 1768

 Score = 30.3 bits (65), Expect = 4.1
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query: 771 IGGKACWDASALYFDPSGG--QLEGGPGTQFA 860
           +GG  CW + A +  P GG  + E G G QFA
Sbjct: 132 VGGCGCWWSHAYFRCPGGGRSEAEAGQGRQFA 163


>BT023158-1|AAY55574.1|  342|Drosophila melanogaster IP09321p
           protein.
          Length = 342

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 22/73 (30%), Positives = 32/73 (43%)
 Frame = -2

Query: 445 PRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSIKY*GPQRTA 266
           P +SS    + SS +     S S P     ++Y+T  ++  S  +PS SS  Y  P  + 
Sbjct: 230 PAVSSYSAPAVSSYSAPAVSSYSAPAVSHGSSYSTSSLSHGSYAAPSVSSKTYAAPAVSH 289

Query: 265 NSAKHSSSDPASG 227
            S   SSS    G
Sbjct: 290 GSYSGSSSGSGHG 302


>AY084178-1|AAL89916.1|  601|Drosophila melanogaster RE52725p
           protein.
          Length = 601

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 522 LGHWPLWSGCQLSCRVSEQH 581
           + HW  W+ C  SC V E H
Sbjct: 537 VSHWSEWTACSKSCGVGEMH 556


>AF000178-1|AAB58341.1|  598|Drosophila melanogaster M-spondin
           protein.
          Length = 598

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 522 LGHWPLWSGCQLSCRVSEQH 581
           + HW  W+ C  SC V E H
Sbjct: 534 VSHWSEWTACSKSCGVGEMH 553


>AE014298-2005|AAF48347.1|  273|Drosophila melanogaster CG11585-PA
           protein.
          Length = 273

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 22/73 (30%), Positives = 32/73 (43%)
 Frame = -2

Query: 445 PRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSIKY*GPQRTA 266
           P +SS    + SS +     S S P     ++Y+T  ++  S  +PS SS  Y  P  + 
Sbjct: 161 PAVSSYSAPAVSSYSAPAVSSYSAPAVSHGSSYSTSSLSHGSYAAPSVSSKTYAAPAVSH 220

Query: 265 NSAKHSSSDPASG 227
            S   SSS    G
Sbjct: 221 GSYSGSSSGSGHG 233


>AE014134-1266|AAF52507.1|  669|Drosophila melanogaster CG5155-PA
           protein.
          Length = 669

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 174 ICACLAQLSTSCHRDTVKPLAGSLLLCLAE 263
           I   +AQL  SCH D V P+ G++  C +E
Sbjct: 251 IVPLMAQLLKSCHIDVVIPIMGTVRKCSSE 280


>AE013599-1935|AAF58219.1|  601|Drosophila melanogaster CG10145-PA
           protein.
          Length = 601

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 522 LGHWPLWSGCQLSCRVSEQH 581
           + HW  W+ C  SC V E H
Sbjct: 537 VSHWSEWTACSKSCGVGEMH 556


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 43,481,969
Number of Sequences: 53049
Number of extensions: 970165
Number of successful extensions: 3244
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 3025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3239
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4771654299
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).