SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069099-1|AAL39244.1|  562|Drosophila melanogaster GH11670p pro...   340   1e-93
AE014296-1577|AAN11983.1|  356|Drosophila melanogaster CG32031-P...   340   1e-93
AE014296-1576|AAF50326.2|  396|Drosophila melanogaster CG32031-P...   340   1e-93
AE014296-1575|AAN11982.1|  432|Drosophila melanogaster CG32031-P...   340   1e-93
AE014296-1574|AAF50325.2|  562|Drosophila melanogaster CG32031-P...   340   1e-93
U26940-1|AAA68173.1|  264|Drosophila melanogaster arginine kinas...   319   3e-87
U26939-1|AAA68172.1|  354|Drosophila melanogaster arginine kinas...   319   3e-87
AY075230-1|AAL68097.1|  214|Drosophila melanogaster AT19006p pro...   258   8e-69
AE014296-1573|AAF50327.1|  388|Drosophila melanogaster CG5144-PA...   258   8e-69
BT012434-1|AAS93705.1|  400|Drosophila melanogaster RH66859p pro...   215   5e-56
AY118820-1|AAM50680.1|  457|Drosophila melanogaster GH24918p pro...   191   7e-49
AE014297-2097|AAF55238.2|  457|Drosophila melanogaster CG4546-PA...   191   7e-49
AE013599-3477|AAM71129.1|  468|Drosophila melanogaster CG30274-P...    61   1e-09

>AY069099-1|AAL39244.1|  562|Drosophila melanogaster GH11670p
           protein.
          Length = 562

 Score =  340 bits (835), Expect = 1e-93
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 375 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 434

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 435 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 494

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 495 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 554

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 555 LIKLEKSL 562


>AE014296-1577|AAN11983.1|  356|Drosophila melanogaster CG32031-PD,
           isoform D protein.
          Length = 356

 Score =  340 bits (835), Expect = 1e-93
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 169 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 228

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 229 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 288

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 289 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 348

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 349 LIKLEKSL 356


>AE014296-1576|AAF50326.2|  396|Drosophila melanogaster CG32031-PC,
           isoform C protein.
          Length = 396

 Score =  340 bits (835), Expect = 1e-93
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 209 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 269 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 328

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 329 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 388

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 389 LIKLEKSL 396


>AE014296-1575|AAN11982.1|  432|Drosophila melanogaster CG32031-PB,
           isoform B protein.
          Length = 432

 Score =  340 bits (835), Expect = 1e-93
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 245 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 304

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 305 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 364

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 365 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 424

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 425 LIKLEKSL 432


>AE014296-1574|AAF50325.2|  562|Drosophila melanogaster CG32031-PA,
           isoform A protein.
          Length = 562

 Score =  340 bits (835), Expect = 1e-93
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 375 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 434

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 435 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 494

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 495 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 554

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 555 LIKLEKSL 562


>U26940-1|AAA68173.1|  264|Drosophila melanogaster arginine kinase
           protein.
          Length = 264

 Score =  319 bits (783), Expect = 3e-87
 Identities = 149/187 (79%), Positives = 162/187 (86%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 79  PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 138

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+ ASVHI   
Sbjct: 139 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTILASVHIKVP 198

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQV   R EHTEAEGG YDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 199 KLPSNKAKLEEVAAKYNLQVANPR-EHTEAEGGSYDISNKRRMGLTEFEAVKEMYDGITE 257

Query: 202 LIKIEKS 182
           LIK+EKS
Sbjct: 258 LIKLEKS 264


>U26939-1|AAA68172.1|  354|Drosophila melanogaster arginine kinase
           protein.
          Length = 354

 Score =  319 bits (783), Expect = 3e-87
 Identities = 149/187 (79%), Positives = 162/187 (86%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 169 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 228

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+ ASVHI   
Sbjct: 229 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTILASVHIKVP 288

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQV   R EHTEAEGG YDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 289 KLPSNKAKLEEVAAKYNLQVANPR-EHTEAEGGSYDISNKRRMGLTEFEAVKEMYDGITE 347

Query: 202 LIKIEKS 182
           LIK+EKS
Sbjct: 348 LIKLEKS 354


>AY075230-1|AAL68097.1|  214|Drosophila melanogaster AT19006p
           protein.
          Length = 214

 Score =  258 bits (631), Expect = 8e-69
 Identities = 115/185 (62%), Positives = 146/185 (78%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  Q+QLI+DH+LFKEGDRF+ +A A R+WPTGRGI+ N  K FLVWCNEEDH+
Sbjct: 24  PLTGMDKCIQEQLIEDHYLFKEGDRFLASAGASRYWPTGRGIFLNSAKNFLVWCNEEDHI 83

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISM+ GGDL +VY R+V  V  + K++ F+  +RLGFLTFCPTNLGT++RASVHI   
Sbjct: 84  RIISMEKGGDLGKVYDRMVGGVEALGKQLQFNRDERLGFLTFCPTNLGTSIRASVHIKLP 143

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   ++++A KY LQ+RGT GEH+EA+GGV+DISN+RRMGLTEY+ +KEM+DGI  
Sbjct: 144 NLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHDISNQRRMGLTEYEIIKEMHDGIKG 203

Query: 202 LIKIE 188
           LI+ E
Sbjct: 204 LIEAE 208


>AE014296-1573|AAF50327.1|  388|Drosophila melanogaster CG5144-PA
           protein.
          Length = 388

 Score =  258 bits (631), Expect = 8e-69
 Identities = 115/185 (62%), Positives = 146/185 (78%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  Q+QLI+DH+LFKEGDRF+ +A A R+WPTGRGI+ N  K FLVWCNEEDH+
Sbjct: 198 PLTGMDKCIQEQLIEDHYLFKEGDRFLASAGASRYWPTGRGIFLNSAKNFLVWCNEEDHI 257

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISM+ GGDL +VY R+V  V  + K++ F+  +RLGFLTFCPTNLGT++RASVHI   
Sbjct: 258 RIISMEKGGDLGKVYDRMVGGVEALGKQLQFNRDERLGFLTFCPTNLGTSIRASVHIKLP 317

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   ++++A KY LQ+RGT GEH+EA+GGV+DISN+RRMGLTEY+ +KEM+DGI  
Sbjct: 318 NLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHDISNQRRMGLTEYEIIKEMHDGIKG 377

Query: 202 LIKIE 188
           LI+ E
Sbjct: 378 LIEAE 382


>BT012434-1|AAS93705.1|  400|Drosophila melanogaster RH66859p
           protein.
          Length = 400

 Score =  215 bits (525), Expect = 5e-56
 Identities = 95/157 (60%), Positives = 121/157 (77%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  Q+QLI+DH+LFKE DRF+ +A A R+WPTGRGI+ N  K FLVWCNEEDH+
Sbjct: 216 PLTGMDKCIQEQLIEDHYLFKESDRFLASAGASRYWPTGRGIFLNSAKNFLVWCNEEDHI 275

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISM+ GGDL +VY R+V  V  + K++ F+  +RLGFLTFCPTNLGT++RASVHI   
Sbjct: 276 RIISMEKGGDLGKVYDRMVGGVEALGKQLQFNRDERLGFLTFCPTNLGTSIRASVHIKLP 335

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDI 272
                   ++++A KY LQ+RGT GEH+EA+GGV+DI
Sbjct: 336 NLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHDI 372


>AY118820-1|AAM50680.1|  457|Drosophila melanogaster GH24918p
           protein.
          Length = 457

 Score =  191 bits (466), Expect = 7e-49
 Identities = 91/188 (48%), Positives = 120/188 (63%), Gaps = 1/188 (0%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           +  +  ETQ +++  H LF+ GD  +  A   RFWPTGRG+YHN  +TFL+W N +DH+ 
Sbjct: 263 MADIDAETQAEMVKRHILFQRGDEKLTTAGCYRFWPTGRGVYHNPAETFLIWVNRQDHVH 322

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXX 380
           I+SM   GDL  VY RLV+ + E+EK + F+ H R G LT CPTNLGTT+RASVHI    
Sbjct: 323 IMSMAQCGDLGDVYNRLVNGLTELEKTLAFARHPRYGNLTACPTNLGTTLRASVHIRLPL 382

Query: 379 XXXXXXXLEEVASKYHLQVRGT-RGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                  L  +A +  LQVRGT  GE +  E GV DISNKR++G TE++ VK + DG+  
Sbjct: 383 LSKDPDRLLALAEEQQLQVRGTDGGELSTVEDGVMDISNKRKLGFTEFELVKTLQDGVVT 442

Query: 202 LIKIEKSL 179
           LI  E+ L
Sbjct: 443 LINAEEEL 450


>AE014297-2097|AAF55238.2|  457|Drosophila melanogaster CG4546-PA
           protein.
          Length = 457

 Score =  191 bits (466), Expect = 7e-49
 Identities = 91/188 (48%), Positives = 120/188 (63%), Gaps = 1/188 (0%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           +  +  ETQ +++  H LF+ GD  +  A   RFWPTGRG+YHN  +TFL+W N +DH+ 
Sbjct: 263 MADIDAETQAEMVKRHILFQRGDEKLTTAGCYRFWPTGRGVYHNPAETFLIWVNRQDHVH 322

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXX 380
           I+SM   GDL  VY RLV+ + E+EK + F+ H R G LT CPTNLGTT+RASVHI    
Sbjct: 323 IMSMAQCGDLGDVYNRLVNGLTELEKTLAFARHPRYGNLTACPTNLGTTLRASVHIRLPL 382

Query: 379 XXXXXXXLEEVASKYHLQVRGT-RGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                  L  +A +  LQVRGT  GE +  E GV DISNKR++G TE++ VK + DG+  
Sbjct: 383 LSKDPDRLLALAEEQQLQVRGTDGGELSTVEDGVMDISNKRKLGFTEFELVKTLQDGVVT 442

Query: 202 LIKIEKSL 179
           LI  E+ L
Sbjct: 443 LINAEEEL 450


>AE013599-3477|AAM71129.1|  468|Drosophila melanogaster CG30274-PA
           protein.
          Length = 468

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 45/170 (26%), Positives = 76/170 (44%), Gaps = 8/170 (4%)
 Frame = -3

Query: 664 MQAANACRF----WPTGRGIYHNENKTFLVWCNEEDHLRIISMQMG---GDLQQVYKRLV 506
           +QAA +  F    WP GRG + N      VW N ++HLRIIS        D+   Y R+ 
Sbjct: 278 VQAAESTAFNGALWPYGRGAFVNSANNMAVWLNCQEHLRIISTTSSKEPADMGAAYTRVG 337

Query: 505 SAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHL- 329
            A+  +E ++ F     LG+L   P+ LGT ++ +  +           ++E+ +  HL 
Sbjct: 338 RAITYLETQLHFKESYLLGYLQSRPSYLGTGLKMTTIV------KLTNLMKEMDNLRHLC 391

Query: 328 QVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
            VRG              + N + MG+ EY   ++    +  ++ +EK +
Sbjct: 392 SVRGLSMVTNRLSKLTVRLVNMQSMGVVEYVLFQDYCTAVTNILSLEKDM 441


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,410,007
Number of Sequences: 53049
Number of extensions: 433883
Number of successful extensions: 1716
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1708
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3375989364
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).