SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M22536-1|AAA28998.1|  156|Drosophila melanogaster protein ( D.me...   210   3e-54
BT001653-1|AAN71408.1|  156|Drosophila melanogaster RE44350p pro...   210   3e-54
AE014134-1875|AAF52941.1|  156|Drosophila melanogaster CG5271-PA...   210   3e-54
X69119-1|CAA48871.1|   76|Drosophila melanogaster Ubiquitin-80 p...   112   7e-25
X59943-1|CAA42568.1|  128|Drosophila melanogaster ubiquitin exte...   112   7e-25
X53059-1|CAA37227.1|  128|Drosophila melanogaster protein ( Frui...   112   7e-25
M33122-1|AAA29007.1|   76|Drosophila melanogaster protein ( D.me...   112   7e-25
M33015-1|AAA29001.1|   76|Drosophila melanogaster protein ( D.me...   112   7e-25
M33013-1|AAA28999.1|   76|Drosophila melanogaster protein ( D.me...   112   7e-25
M22428-1|AAA28997.1|  231|Drosophila melanogaster protein ( D.me...   112   7e-25
AY118702-1|AAM50562.1| 1067|Drosophila melanogaster AT20865p pro...   112   7e-25
AY118459-1|AAM49828.1|  306|Drosophila melanogaster GH17513p pro...   112   7e-25
AY075451-1|AAL68264.1|  128|Drosophila melanogaster RE10554p pro...   112   7e-25
AE014298-864|AAF46142.3|  534|Drosophila melanogaster CG32744-PA...   112   7e-25
AE014296-712|AAS64964.1|  763|Drosophila melanogaster CG11624-PC...   112   7e-25
AE014296-711|AAG22241.2|  763|Drosophila melanogaster CG11624-PB...   112   7e-25
AE014296-710|AAF47806.3|  763|Drosophila melanogaster CG11624-PA...   112   7e-25
AE014134-712|AAF51034.1|  128|Drosophila melanogaster CG2960-PA ...   112   7e-25
M33016-1|AAA29002.1|   76|Drosophila melanogaster protein ( D.me...   110   3e-24
M33014-1|AAA29000.1|   76|Drosophila melanogaster protein ( D.me...   110   3e-24
M33121-1|AAA29006.1|   76|Drosophila melanogaster protein ( D.me...   109   4e-24
M33018-1|AAA29004.1|   76|Drosophila melanogaster protein ( D.me...   107   2e-23
AE014298-866|AAF46143.1|  301|Drosophila melanogaster CG11700-PA...   107   2e-23
M33017-1|AAA29003.1|   76|Drosophila melanogaster protein ( D.me...   105   1e-22
M33019-1|AAA29005.1|   75|Drosophila melanogaster protein ( D.me...   103   3e-22
BT024445-1|ABC86507.1|   84|Drosophila melanogaster IP01714p pro...    75   1e-13
AE014134-2997|AAF53724.1|   84|Drosophila melanogaster CG10679-P...    75   1e-13
M37606-1|AAA28822.1|   75|Drosophila melanogaster protein ( D.me...    69   9e-12
M37610-1|AAA28826.1|  152|Drosophila melanogaster protein ( D.me...    62   8e-10
M37605-1|AAA28821.1|   76|Drosophila melanogaster protein ( D.me...    61   2e-09
M37609-1|AAA28825.1|  152|Drosophila melanogaster protein ( D.me...    58   2e-08
M37608-1|AAA28824.1|   76|Drosophila melanogaster protein ( D.me...    57   4e-08
M37607-1|AAA28823.1|   76|Drosophila melanogaster protein ( D.me...    57   4e-08
AY047530-1|AAK77262.1|  784|Drosophila melanogaster GH03554p pro...    50   6e-06
AE014297-2286|AAF55372.1|  784|Drosophila melanogaster CG16941-P...    50   6e-06
AY093423-1|AAM18800.2|  482|Drosophila melanogaster PARKIN protein.    46   7e-05
AY058754-1|AAL13983.1|  482|Drosophila melanogaster SD01679p pro...    46   7e-05
AF510072-1|AAM43930.1|  482|Drosophila melanogaster PARKIN protein.    46   7e-05
AE014296-3479|AAN12155.1|  482|Drosophila melanogaster CG10523-P...    46   7e-05
AE014296-3478|AAN12154.1|  482|Drosophila melanogaster CG10523-P...    46   7e-05
AY128447-1|AAM75040.1|  547|Drosophila melanogaster LD38919p pro...    39   0.011
AE014298-2913|AAF49003.1|  547|Drosophila melanogaster CG14224-P...    39   0.011
AY261675-1|AAP20871.1|   86|Drosophila melanogaster PARKIN protein.    38   0.019
AF136606-1|AAD33695.1|  414|Drosophila melanogaster DHR23 protein.     34   0.23 
AF132147-1|AAD33594.1|  414|Drosophila melanogaster DNA repair p...    34   0.23 
AE014135-60|AAF59352.1|  414|Drosophila melanogaster CG1836-PA, ...    34   0.23 
AY094669-1|AAM11022.1| 1122|Drosophila melanogaster GH03394p pro...    32   1.2  
AE014298-1481|AAF46623.2| 1122|Drosophila melanogaster CG32676-P...    32   1.2  
AY118721-1|AAM50581.1|  161|Drosophila melanogaster GH01560p pro...    30   4.9  
AY113628-1|AAM29633.1|  700|Drosophila melanogaster RH71315p pro...    30   4.9  
AE014298-1540|AAF47989.1|  161|Drosophila melanogaster CG1545-PA...    30   4.9  
AY084174-1|AAL89912.1|  249|Drosophila melanogaster RE42193p pro...    29   6.5  
AE014297-243|AAF52034.1|  249|Drosophila melanogaster CG1172-PA ...    29   6.5  

>M22536-1|AAA28998.1|  156|Drosophila melanogaster protein (
           D.melanogaster ubiquitin-hybrid (UB3-D) mRNA, complete
           cds. ).
          Length = 156

 Score =  210 bits (512), Expect = 3e-54
 Identities = 104/140 (74%), Positives = 110/140 (78%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 KNYSTP          KLAVL++YKVDENGKIHRLRREC GE CGAGVFMA  E
Sbjct: 77  AKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGENCGAGVFMAAHE 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC+ T VF K ++K
Sbjct: 137 DRHYCGKCNLTFVFSKPEEK 156


>BT001653-1|AAN71408.1|  156|Drosophila melanogaster RE44350p
           protein.
          Length = 156

 Score =  210 bits (512), Expect = 3e-54
 Identities = 104/140 (74%), Positives = 110/140 (78%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 KNYSTP          KLAVL++YKVDENGKIHRLRREC GE CGAGVFMA  E
Sbjct: 77  AKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGENCGAGVFMAAHE 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC+ T VF K ++K
Sbjct: 137 DRHYCGKCNLTFVFSKPEEK 156


>AE014134-1875|AAF52941.1|  156|Drosophila melanogaster CG5271-PA
           protein.
          Length = 156

 Score =  210 bits (512), Expect = 3e-54
 Identities = 104/140 (74%), Positives = 110/140 (78%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 KNYSTP          KLAVL++YKVDENGKIHRLRREC GE CGAGVFMA  E
Sbjct: 77  AKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGENCGAGVFMAAHE 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC+ T VF K ++K
Sbjct: 137 DRHYCGKCNLTFVFSKPEEK 156


>X69119-1|CAA48871.1|   76|Drosophila melanogaster Ubiquitin-80
           protein.
          Length = 76

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>X59943-1|CAA42568.1|  128|Drosophila melanogaster ubiquitin
           extension protein protein.
          Length = 128

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>X53059-1|CAA37227.1|  128|Drosophila melanogaster protein ( Fruit
           fly mRNA for ubiquitin52-AA extension protein. ).
          Length = 128

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33122-1|AAA29007.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33015-1|AAA29001.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33013-1|AAA28999.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M22428-1|AAA28997.1|  231|Drosophila melanogaster protein (
           D.melanogaster ubiquitinprotein gene, complete cds. ).
          Length = 231

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>AY118702-1|AAM50562.1| 1067|Drosophila melanogaster AT20865p
           protein.
          Length = 1067

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 701 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 754



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 777 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 830



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 853  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 906



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 929  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 982



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1005 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1058


>AY118459-1|AAM49828.1|  306|Drosophila melanogaster GH17513p
           protein.
          Length = 306

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298


>AY075451-1|AAL68264.1|  128|Drosophila melanogaster RE10554p
           protein.
          Length = 128

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>AE014298-864|AAF46142.3|  534|Drosophila melanogaster CG32744-PA
           protein.
          Length = 534

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526


>AE014296-712|AAS64964.1|  763|Drosophila melanogaster CG11624-PC,
           isoform C protein.
          Length = 763

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 701 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 754


>AE014296-711|AAG22241.2|  763|Drosophila melanogaster CG11624-PB,
           isoform B protein.
          Length = 763

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 701 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 754


>AE014296-710|AAF47806.3|  763|Drosophila melanogaster CG11624-PA,
           isoform A protein.
          Length = 763

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678



 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 701 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 754


>AE014134-712|AAF51034.1|  128|Drosophila melanogaster CG2960-PA
           protein.
          Length = 128

 Score =  112 bits (269), Expect = 7e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33016-1|AAA29002.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  110 bits (264), Expect = 3e-24
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDT ENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTXENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33014-1|AAA29000.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  110 bits (264), Expect = 3e-24
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDT ENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTTENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>M33121-1|AAA29006.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  109 bits (263), Expect = 4e-24
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGK LEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYNIQKESTLHLV 70


>M33018-1|AAA29004.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  107 bits (258), Expect = 2e-23
 Identities = 51/54 (94%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEG PP+QQRLIFAGK LEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGXPPDQQRLIFAGKXLEDGRTLSDYNIQKESTLHLV 70


>AE014298-866|AAF46143.1|  301|Drosophila melanogaster CG11700-PA
           protein.
          Length = 301

 Score =  107 bits (257), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSD+IENVKA+I DKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score = 99.1 bits (236), Expect = 7e-21
 Identities = 45/52 (86%), Positives = 50/52 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLH 736
           VEPSDTI++VKA+I DK+GIPP+ QRLIFAGKQLEDGRTLSDYNIQKESTLH
Sbjct: 245 VEPSDTIKHVKARIHDKDGIPPDHQRLIFAGKQLEDGRTLSDYNIQKESTLH 296



 Score = 95.1 bits (226), Expect = 1e-19
 Identities = 45/54 (83%), Positives = 48/54 (88%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKE  PP  QRLIF GK LE+GRTLSDYNIQKEST++LV
Sbjct: 17  VEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLV 70



 Score = 95.1 bits (226), Expect = 1e-19
 Identities = 45/54 (83%), Positives = 48/54 (88%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKE  PP  QRLIF GK LE+GRTLSDYNIQKEST++LV
Sbjct: 93  VEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLV 146


>M33017-1|AAA29003.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  105 bits (251), Expect = 1e-22
 Identities = 50/54 (92%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDT ENVKAKIQDKEGIPP+QQRLIFAGKQL  GRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTXENVKAKIQDKEGIPPDQQRLIFAGKQLXXGRTLSDYNIQKESTLHLV 70


>M33019-1|AAA29005.1|   75|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 75

 Score =  103 bits (248), Expect = 3e-22
 Identities = 51/54 (94%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQR IFAGKQL DGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQR-IFAGKQLXDGRTLSDYNIQKESTLHLV 69


>BT024445-1|ABC86507.1|   84|Drosophila melanogaster IP01714p
           protein.
          Length = 84

 Score = 75.4 bits (177), Expect = 1e-13
 Identities = 29/54 (53%), Positives = 43/54 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D ++ +K ++++KEGIPP QQRLIF+GKQ+ D +T +DY +Q  S LHLV
Sbjct: 17  IEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLHLV 70


>AE014134-2997|AAF53724.1|   84|Drosophila melanogaster CG10679-PA
           protein.
          Length = 84

 Score = 75.4 bits (177), Expect = 1e-13
 Identities = 29/54 (53%), Positives = 43/54 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D ++ +K ++++KEGIPP QQRLIF+GKQ+ D +T +DY +Q  S LHLV
Sbjct: 17  IEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLHLV 70


>M37606-1|AAA28822.1|   75|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 75

 Score = 68.9 bits (161), Expect = 9e-12
 Identities = 30/55 (54%), Positives = 44/55 (80%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           TT+ ++QV+GG LLD+V+ +G S+FQLL+S+DQ LLI  DSL +LN   +IL+G+
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVFQLLASEDQTLLIWGDSLLILNLGLYILNGV 71


>M37610-1|AAA28826.1|  152|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 152

 Score = 62.5 bits (145), Expect = 8e-10
 Identities = 27/55 (49%), Positives = 40/55 (72%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           TT+ ++QV+GG LLD+V+ +G S+   L+ +DQ LLI  DSL +LN   HIL+G+
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVXXXLAGEDQTLLIWGDSLLILNLGLHILNGV 71



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 22/52 (42%), Positives = 26/52 (50%)
 Frame = +3

Query: 720 EASTPGGGWIPSGYCSPRGYVHLPAAFQQRSTFVDWEGFPLCLEF*LSHSRW 875
           E   P  GW PSG C+  G VH  AA ++RS   D   FP   E    HS+W
Sbjct: 95  ETXEPSEGWTPSGCCNRTGCVHPQAACRRRSDAADLGEFPPYPESWPLHSQW 146


>M37605-1|AAA28821.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 61.3 bits (142), Expect = 2e-09
 Identities = 27/51 (52%), Positives = 38/51 (74%)
 Frame = +1

Query: 727 QHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++QV+GG LLD+V+ +G SI +LL+ +DQ LLI  DSL +LN   HIL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGDSLLILNLGLHILGGV 72


>M37609-1|AAA28825.1|  152|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 152

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 26/55 (47%), Positives = 38/55 (69%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           TT+ ++QV+GG LLD+V+ +G S    L+ +DQ LLI   SL +LN   HIL+G+
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASXXXXLAGEDQTLLIWGXSLLILNLGLHILNGV 71



 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 23/52 (44%), Positives = 27/52 (51%)
 Frame = +3

Query: 720 EASTPGGGWIPSGYCSPRGYVHLPAAFQQRSTFVDWEGFPLCLEF*LSHSRW 875
           E   P  GW P G C+  G V LP A ++RS   D  GFP   E   SHS+W
Sbjct: 95  ETXEPSEGWTPFGCCNRTGCVRLPVACRRRSDAADLGGFPPYPESWPSHSQW 146


>M37608-1|AAA28824.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 25/51 (49%), Positives = 38/51 (74%)
 Frame = +1

Query: 727 QHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++QV+GG LLD+V+ +G SI +LL+ +DQ LLI  +SL +LN   +IL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGNSLLILNLGLYILXGV 72


>M37607-1|AAA28823.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 25/51 (49%), Positives = 38/51 (74%)
 Frame = +1

Query: 727 QHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++QV+GG LLD+V+ +G SI +LL+ +DQ LLI  +SL +LN   +IL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGNSLLILNLGLYILXGV 72


>AY047530-1|AAK77262.1|  784|Drosophila melanogaster GH03554p
           protein.
          Length = 784

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+HL
Sbjct: 725 SEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHL 774


>AE014297-2286|AAF55372.1|  784|Drosophila melanogaster CG16941-PA
           protein.
          Length = 784

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+HL
Sbjct: 725 SEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHL 774


>AY093423-1|AAM18800.2|  482|Drosophila melanogaster PARKIN protein.
          Length = 482

 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>AY058754-1|AAL13983.1|  482|Drosophila melanogaster SD01679p
           protein.
          Length = 482

 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>AF510072-1|AAM43930.1|  482|Drosophila melanogaster PARKIN protein.
          Length = 482

 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>AE014296-3479|AAN12155.1|  482|Drosophila melanogaster CG10523-PC,
           isoform C protein.
          Length = 482

 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>AE014296-3478|AAN12154.1|  482|Drosophila melanogaster CG10523-PB,
           isoform B protein.
          Length = 482

 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>AY128447-1|AAM75040.1|  547|Drosophila melanogaster LD38919p
           protein.
          Length = 547

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+    I++ K  +  K    P Q  LIFAGK ++D  TL  +NI+   T+HLV
Sbjct: 24  VDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLV 77


>AE014298-2913|AAF49003.1|  547|Drosophila melanogaster CG14224-PA
           protein.
          Length = 547

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+    I++ K  +  K    P Q  LIFAGK ++D  TL  +NI+   T+HLV
Sbjct: 24  VDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLV 77


>AY261675-1|AAP20871.1|   86|Drosophila melanogaster PARKIN protein.
          Length = 86

 Score = 37.9 bits (84), Expect = 0.019
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTL 772
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTI 85


>AF136606-1|AAD33695.1|  414|Drosophila melanogaster DHR23 protein.
          Length = 414

 Score = 34.3 bits (75), Expect = 0.23
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           P  T+  +K KI ++ G      +Q+LI+AG  L D RT+  YN+ ++
Sbjct: 19  PEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEK 66


>AF132147-1|AAD33594.1|  414|Drosophila melanogaster DNA repair
           protein Rad23 protein.
          Length = 414

 Score = 34.3 bits (75), Expect = 0.23
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           P  T+  +K KI ++ G      +Q+LI+AG  L D RT+  YN+ ++
Sbjct: 19  PEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEK 66


>AE014135-60|AAF59352.1|  414|Drosophila melanogaster CG1836-PA,
           isoform A protein.
          Length = 414

 Score = 34.3 bits (75), Expect = 0.23
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           P  T+  +K KI ++ G      +Q+LI+AG  L D RT+  YN+ ++
Sbjct: 19  PEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEK 66


>AY094669-1|AAM11022.1| 1122|Drosophila melanogaster GH03394p
           protein.
          Length = 1122

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEP  ++E++K  I  K  +  ++  L+   K+L+DG TL D+N+   S + L+
Sbjct: 85  VEPHISVESLKKIIAKKLKVAKDRICLLHREKELQDG-TLRDHNLMDGSKIILI 137


>AE014298-1481|AAF46623.2| 1122|Drosophila melanogaster CG32676-PA
           protein.
          Length = 1122

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEP  ++E++K  I  K  +  ++  L+   K+L+DG TL D+N+   S + L+
Sbjct: 85  VEPHISVESLKKIIAKKLKVAKDRICLLHREKELQDG-TLRDHNLMDGSKIILI 137


>AY118721-1|AAM50581.1|  161|Drosophila melanogaster GH01560p
           protein.
          Length = 161

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -3

Query: 323 LCSFCSYEYGNWSAHCQGSFNS 258
           LC  C Y +G+W++ C    NS
Sbjct: 71  LCCLCDYNHGSWASQCWKKHNS 92


>AY113628-1|AAM29633.1|  700|Drosophila melanogaster RH71315p
           protein.
          Length = 700

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 487 RRRQINKSPLACKERSRLLCMMDFK*NLDTVSELTRWFYLLKGNFFDEKTIVHRTCAASV 308
           ++ QINK P+  +     +    FK     + ELT+   L+K N  + KTI       +V
Sbjct: 495 QQAQINKIPVFFEPTDMFIAGKPFK----LLPELTKNIRLIKPNMQELKTITEAITGETV 550

Query: 307 LMNMEIGLPTVKEVSILSRAPTLLSQL-FKFLCI 209
             N E   P   +  ++ +A +L+ ++  +F CI
Sbjct: 551 KWNPETKQP---QTELVQQAKSLIKKIDSRFNCI 581


>AE014298-1540|AAF47989.1|  161|Drosophila melanogaster CG1545-PA
           protein.
          Length = 161

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -3

Query: 323 LCSFCSYEYGNWSAHCQGSFNS 258
           LC  C Y +G+W++ C    NS
Sbjct: 71  LCCLCDYNHGSWASQCWKKHNS 92


>AY084174-1|AAL89912.1|  249|Drosophila melanogaster RE42193p
           protein.
          Length = 249

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   DT+   K K+Q  EG+    QR  ++GK L D   + + +I +   + ++
Sbjct: 178 VYSKDTVGQCKKKLQAAEGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVI 231


>AE014297-243|AAF52034.1|  249|Drosophila melanogaster CG1172-PA
           protein.
          Length = 249

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   DT+   K K+Q  EG+    QR  ++GK L D   + + +I +   + ++
Sbjct: 178 VYSKDTVGQCKKKLQAAEGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVI 231


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,717,751
Number of Sequences: 53049
Number of extensions: 749841
Number of successful extensions: 1917
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 1733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1916
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4352837424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).