SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY094820-1|AAM11173.1|  609|Drosophila melanogaster LD34893p pro...    31   1.2  
AE013599-2637|AAF57737.2|  609|Drosophila melanogaster CG10915-P...    31   1.2  
BT021409-1|AAX33557.1|  580|Drosophila melanogaster LD06533p pro...    29   3.7  
AE014298-1701|AAN09303.1|  580|Drosophila melanogaster CG10347-P...    29   3.7  
AE014298-1700|AAF48103.1|  580|Drosophila melanogaster CG10347-P...    29   3.7  

>AY094820-1|AAM11173.1|  609|Drosophila melanogaster LD34893p
           protein.
          Length = 609

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +2

Query: 218 SGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 337
           SG  G A   +    +V+       PM APP PSP+ M P
Sbjct: 475 SGSIGVAATAAAVAASVETAATVTVPMVAPPSPSPAKMQP 514


>AE013599-2637|AAF57737.2|  609|Drosophila melanogaster CG10915-PA
           protein.
          Length = 609

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +2

Query: 218 SGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 337
           SG  G A   +    +V+       PM APP PSP+ M P
Sbjct: 475 SGSIGVAATAAAVAASVETAATVTVPMVAPPSPSPAKMQP 514


>BT021409-1|AAX33557.1|  580|Drosophila melanogaster LD06533p
           protein.
          Length = 580

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 281 ERVAPMQAPPEPSPSIMAPYE 343
           E V PM+APP P PS+  P E
Sbjct: 386 EEVHPMEAPPLPIPSLQDPVE 406


>AE014298-1701|AAN09303.1|  580|Drosophila melanogaster CG10347-PB,
           isoform B protein.
          Length = 580

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 281 ERVAPMQAPPEPSPSIMAPYE 343
           E V PM+APP P PS+  P E
Sbjct: 386 EEVHPMEAPPLPIPSLQDPVE 406


>AE014298-1700|AAF48103.1|  580|Drosophila melanogaster CG10347-PA,
           isoform A protein.
          Length = 580

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 281 ERVAPMQAPPEPSPSIMAPYE 343
           E V PM+APP P PS+  P E
Sbjct: 386 EEVHPMEAPPLPIPSLQDPVE 406


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,710,786
Number of Sequences: 53049
Number of extensions: 503181
Number of successful extensions: 1739
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1630
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1733
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2462276481
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).