SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   500   e-141
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   500   e-141
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   500   e-141
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   500   e-141
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   500   e-141
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   500   e-141
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   500   e-141
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   500   e-141
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   500   e-141
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   494   e-140
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   494   e-140
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   493   e-140
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   493   e-140
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   493   e-140
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   493   e-140
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   493   e-140
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   493   e-140
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   488   e-138
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   488   e-138
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   488   e-138
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   487   e-138
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   487   e-138
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    487   e-138
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   485   e-137
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   482   e-136
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   462   e-130
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   335   3e-92
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   335   3e-92
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   329   3e-90
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   321   8e-88
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   287   2e-77
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   287   2e-77
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   287   2e-77
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...   244   8e-65
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...   244   8e-65
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...   241   1e-63
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...   186   3e-47
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...   186   3e-47
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   184   1e-46
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...   182   5e-46
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...   128   1e-29
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...   128   1e-29
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    94   2e-19
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    94   2e-19
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    94   2e-19
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    87   3e-17
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    87   3e-17
AF156227-1|AAD43809.1|  258|Drosophila melanogaster salivary gla...    39   0.007
AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA ...    39   0.007
BT003608-1|AAO39611.1|  377|Drosophila melanogaster GH19274p pro...    38   0.016
BT003318-1|AAO25078.1|  517|Drosophila melanogaster AT26991p pro...    38   0.016
BT001317-1|AAN71072.1|  517|Drosophila melanogaster AT15066p pro...    38   0.016
AE014296-204|AAN11465.1|  517|Drosophila melanogaster CG9130-PB,...    38   0.016
AE014296-203|AAN11464.1|  517|Drosophila melanogaster CG9130-PA,...    38   0.016
BT022491-1|AAY54907.1|  173|Drosophila melanogaster IP07937p pro...    37   0.036
AE014298-1527|AAF47979.1|  592|Drosophila melanogaster CG2145-PA...    35   0.11 
AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-P...    34   0.25 
AY118441-1|AAM48470.1|  961|Drosophila melanogaster SD06668p pro...    32   0.78 
AE014297-3591|AAS65210.1|  715|Drosophila melanogaster CG6695-PB...    32   0.78 
AE014297-3590|AAF56321.3|  961|Drosophila melanogaster CG6695-PA...    32   0.78 
AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-P...    32   0.78 
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.78 
U24246-1|AAA65115.1|  393|Drosophila melanogaster I71-7 protein.       32   1.0  
U23836-4|AAA74179.1|  393|Drosophila melanogaster I71-7 protein.       32   1.0  
BT025138-1|ABE73309.1|  175|Drosophila melanogaster IP06825p pro...    32   1.0  
AY119006-1|AAM50866.1|  445|Drosophila melanogaster LP03361p pro...    32   1.0  
AE014296-2557|AAF49596.1|  445|Drosophila melanogaster CG7604-PA...    32   1.0  
AE014296-854|AAF47906.1|  172|Drosophila melanogaster CG15023-PA...    32   1.0  
AY094826-1|AAM11179.1| 1266|Drosophila melanogaster LD39940p pro...    31   1.4  
AY051631-1|AAK93055.1|  506|Drosophila melanogaster GH28016p pro...    31   1.4  
AL031028-1|CAA19845.2| 1795|Drosophila melanogaster EG:56G7.1 pr...    31   1.4  
AE014298-231|AAF45644.1| 1795|Drosophila melanogaster CG14796-PA...    31   1.4  
AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-P...    31   1.4  
X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.       31   1.8  
M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2 ...    31   1.8  
M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2 ...    31   1.8  
M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2 ...    31   1.8  
M23633-1|AAA28953.1|  264|Drosophila melanogaster protein ( D.me...    31   1.8  
J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2 ...    31   1.8  
AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p pro...    31   1.8  
AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-P...    31   1.8  
AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-P...    31   1.8  
AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-P...    31   1.8  
AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-P...    31   1.8  
AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-P...    31   1.8  
AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-P...    31   1.8  
BT001711-1|AAN71466.1|  182|Drosophila melanogaster RE67695p pro...    31   2.4  
AY118644-1|AAM50013.1|  892|Drosophila melanogaster SD03914p pro...    31   2.4  
AY071124-1|AAL48746.1|  420|Drosophila melanogaster RE17165p pro...    31   2.4  
AF273708-1|AAL35411.1|  118|Drosophila melanogaster PFTAIRE-inte...    31   2.4  
AE014297-3578|ABI31205.1| 1728|Drosophila melanogaster CG34100-P...    31   2.4  
AE014297-3577|AAN14004.2| 1918|Drosophila melanogaster CG34100-P...    31   2.4  
AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA...    31   2.4  
AE014296-1719|AAN11954.1|  182|Drosophila melanogaster CG16707-P...    31   2.4  
AE014296-1718|AAN11953.1|  182|Drosophila melanogaster CG16707-P...    31   2.4  
AE014296-1717|AAN11952.1|  183|Drosophila melanogaster CG16707-P...    31   2.4  
AE014296-1716|AAF50218.1|  183|Drosophila melanogaster CG16707-P...    31   2.4  
AE014296-850|AAF47902.2|  420|Drosophila melanogaster CG15021-PA...    31   2.4  
BT025941-1|ABG02185.1|  207|Drosophila melanogaster IP14143p pro...    30   3.1  
BT025938-1|ABG02182.1|  207|Drosophila melanogaster IP14043p pro...    30   3.1  
BT004503-1|AAO42667.1| 2201|Drosophila melanogaster GH07949p pro...    30   3.1  
AY075568-1|AAL68375.1|  806|Drosophila melanogaster SD01878p pro...    30   3.1  
AY058379-1|AAL13608.1|  967|Drosophila melanogaster GH14389p pro...    30   3.1  
AF434683-1|AAL30427.1|  806|Drosophila melanogaster DUNC-115l pr...    30   3.1  
AE014298-2950|ABC67193.1| 1456|Drosophila melanogaster CG32529-P...    30   3.1  
AE014298-2949|AAF49024.2| 1280|Drosophila melanogaster CG32529-P...    30   3.1  
AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-P...    30   3.1  
AE014297-1009|AAF54427.4|  806|Drosophila melanogaster CG31352-P...    30   3.1  
AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA...    30   3.1  
AE014134-456|AAF51219.1|  521|Drosophila melanogaster CG2843-PA ...    30   3.1  
AY069587-1|AAL39732.2|  639|Drosophila melanogaster LD33388p pro...    30   4.1  
AY069099-1|AAL39244.1|  562|Drosophila melanogaster GH11670p pro...    30   4.1  
AY058785-1|AAL14014.1| 1068|Drosophila melanogaster SD08329p pro...    30   4.1  
AE014297-152|AAF52092.2| 2228|Drosophila melanogaster CG17735-PA...    30   4.1  
AE014296-1574|AAF50325.2|  562|Drosophila melanogaster CG32031-P...    30   4.1  
AE014296-109|AAN11444.1| 1340|Drosophila melanogaster CG17090-PB...    30   4.1  
AE014296-108|AAF47392.2| 1340|Drosophila melanogaster CG17090-PA...    30   4.1  
X01918-3|CAA25994.1|  307|Drosophila melanogaster salivary gland...    29   5.5  
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   5.5  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   5.5  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   5.5  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   5.5  
AE014297-1861|AAF55068.1|  158|Drosophila melanogaster CG14850-P...    29   5.5  
AE014296-1961|AAF50056.1|  307|Drosophila melanogaster CG11720-P...    29   5.5  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   5.5  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   5.5  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   5.5  
AE013599-3304|AAM71024.1|  275|Drosophila melanogaster CG30401-P...    29   5.5  
AE013599-3303|AAM71023.1|  377|Drosophila melanogaster CG30401-P...    29   5.5  
BT029931-1|ABM92805.1|  750|Drosophila melanogaster IP11737p pro...    29   7.2  
BT003320-1|AAO25080.1|  798|Drosophila melanogaster AT11823p pro...    29   7.2  
AY069512-1|AAL39657.1|  857|Drosophila melanogaster LD23217p pro...    29   7.2  
AY069429-1|AAL39574.1|  479|Drosophila melanogaster LD13887p pro...    29   7.2  
AY069327-1|AAL39472.2|  552|Drosophila melanogaster LD04591p pro...    29   7.2  
AE014298-1231|AAS65293.1| 1006|Drosophila melanogaster CG12075-P...    29   7.2  
AE014298-1230|AAF46414.3| 1006|Drosophila melanogaster CG12075-P...    29   7.2  
AE014298-609|AAF45927.1| 1357|Drosophila melanogaster CG15570-PA...    29   7.2  
AE014297-4076|AAF56673.2|  980|Drosophila melanogaster CG6051-PA...    29   7.2  
AE014296-1669|AAF50260.2|  783|Drosophila melanogaster CG32043-P...    29   7.2  
AE014296-1668|AAF50261.2|  783|Drosophila melanogaster CG32043-P...    29   7.2  
AE013599-873|AAF58931.1|  466|Drosophila melanogaster CG12932-PA...    29   7.2  
Y12322-1|CAA72991.1| 1191|Drosophila melanogaster u-shaped protein.    29   9.6  
M27431-1|AAA28868.1| 1896|Drosophila melanogaster protein ( D.me...    29   9.6  
M19537-1|AAA28827.1|  408|Drosophila melanogaster RNA polymerase...    29   9.6  
BT015278-1|AAT94507.1| 1191|Drosophila melanogaster LD12631p pro...    29   9.6  
BT011434-1|AAR99092.1|  765|Drosophila melanogaster RH61815p pro...    29   9.6  
AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro...    29   9.6  
AY089555-1|AAL90293.1| 1429|Drosophila melanogaster LD43558p pro...    29   9.6  
AE014298-1637|AAF48057.1| 1887|Drosophila melanogaster CG1554-PA...    29   9.6  
AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P...    29   9.6  
AE014134-116|AAF51488.2| 1191|Drosophila melanogaster CG2762-PA ...    29   9.6  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-141
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  494 bits (1218), Expect = e-140
 Identities = 232/237 (97%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  494 bits (1218), Expect = e-140
 Identities = 232/237 (97%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  493 bits (1217), Expect = e-140
 Identities = 232/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  488 bits (1204), Expect = e-138
 Identities = 228/237 (96%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  488 bits (1204), Expect = e-138
 Identities = 228/237 (96%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  488 bits (1204), Expect = e-138
 Identities = 228/237 (96%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  487 bits (1202), Expect = e-138
 Identities = 227/237 (95%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  487 bits (1202), Expect = e-138
 Identities = 227/237 (95%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  487 bits (1202), Expect = e-138
 Identities = 227/237 (95%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  485 bits (1197), Expect = e-137
 Identities = 227/237 (95%), Positives = 234/237 (98%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGR LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 LAGRHLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 237


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  482 bits (1189), Expect = e-136
 Identities = 224/237 (94%), Positives = 233/237 (98%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGY+FTTTAEREIVRD KEKLCYVALDFE EMATAA+S+SL
Sbjct: 181 LAGRDLTDYLMKILTERGYTFTTTAEREIVRDTKEKLCYVALDFEDEMATAAASTSL 237


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  462 bits (1139), Expect = e-130
 Identities = 217/221 (98%), Positives = 221/221 (100%)
 Frame = +1

Query: 124 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 303
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 304 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 483
           +TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVA
Sbjct: 61  ITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVA 120

Query: 484 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
           IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
Sbjct: 121 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 180

Query: 664 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA+S+SL
Sbjct: 181 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSL 221


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  335 bits (824), Expect = 3e-92
 Identities = 155/222 (69%), Positives = 185/222 (83%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KRGIL
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 63

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT+IMFE
Sbjct: 64  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFE 122

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            F  PA YVA+QAVLSLYA+GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDL
Sbjct: 123 HFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDL 182

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           TDYL K+L ERG +  T+AEREIVR+IKEKLCYV++++ +EM
Sbjct: 183 TDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEM 224


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  335 bits (824), Expect = 3e-92
 Identities = 155/222 (69%), Positives = 185/222 (83%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 71

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT+IMFE
Sbjct: 72  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFE 130

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            F  PA YVA+QAVLSLYA+GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDL
Sbjct: 131 HFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDL 190

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           TDYL K+L ERG +  T+AEREIVR+IKEKLCYV++++ +EM
Sbjct: 191 TDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEM 232


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  329 bits (808), Expect = 3e-90
 Identities = 152/222 (68%), Positives = 182/222 (81%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEKRGIL 71

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT+IMFE
Sbjct: 72  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFE 130

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            F  PA YVA+QAVLSL  +GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDL
Sbjct: 131 HFQVPAFYVAVQAVLSLCTTGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDL 190

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           TDYL K+L ERG +  T+AEREIVR+IKEKLCYV++++ +EM
Sbjct: 191 TDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEM 232


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  321 bits (788), Expect = 8e-88
 Identities = 158/187 (84%), Positives = 165/187 (88%)
 Frame = +1

Query: 226 KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 405
           K  + GD+A        +  P   G++     MEKIWHHTFYNELRVAPEEHPVLLTEAP
Sbjct: 19  KAGFAGDDAPRAVFPSIVGRPRHQGVMVG---MEKIWHHTFYNELRVAPEEHPVLLTEAP 75

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 585
           LNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY
Sbjct: 76  LNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 135

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 765
           ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT
Sbjct: 136 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 195

Query: 766 AASSSSL 786
           AA+S+SL
Sbjct: 196 AAASTSL 202



 Score =  105 bits (251), Expect = 9e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 219
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  287 bits (703), Expect = 2e-77
 Identities = 125/220 (56%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            N PA++V++QAVLSLYA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T
Sbjct: 132 INAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVT 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            YL  ++   G++F +TAE EIVR IKEK+CY+A + ++E
Sbjct: 192 RYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE 231


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  287 bits (703), Expect = 2e-77
 Identities = 125/220 (56%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            N PA++V++QAVLSLYA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T
Sbjct: 132 INAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVT 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            YL  ++   G++F +TAE EIVR IKEK+CY+A + ++E
Sbjct: 192 RYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE 231


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  287 bits (703), Expect = 2e-77
 Identities = 125/220 (56%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            N PA++V++QAVLSLYA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T
Sbjct: 132 INAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVT 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            YL  ++   G++F +TAE EIVR IKEK+CY+A + ++E
Sbjct: 192 RYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE 231


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score =  244 bits (598), Expect = 8e-65
 Identities = 115/232 (49%), Positives = 159/232 (68%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           E +   + Y+AIQAVL+LYA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD+AGRD
Sbjct: 129 EKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR +KEKLCY+  D E E   A  ++ L
Sbjct: 189 ITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVL 240


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score =  244 bits (598), Expect = 8e-65
 Identities = 115/232 (49%), Positives = 159/232 (68%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           E +   + Y+AIQAVL+LYA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD+AGRD
Sbjct: 129 EKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR +KEKLCY+  D E E   A  ++ L
Sbjct: 189 ITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVL 240


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score =  241 bits (589), Expect = 1e-63
 Identities = 113/232 (48%), Positives = 157/232 (67%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 69

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 70  EVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 129

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           E +   + Y+AIQA  +LYA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD+AGRD
Sbjct: 130 EKYGFDSAYIAIQAAWTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRD 189

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR +KEKLCY+  D E E   A  ++ L
Sbjct: 190 ITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVL 241


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score =  186 bits (453), Expect = 3e-47
 Identities = 99/238 (41%), Positives = 137/238 (57%), Gaps = 16/238 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFETFN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +   I  + +AGR++T ++  +L ER          E  + IKEK CY+  D  +E A
Sbjct: 186 IGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA 243


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score =  186 bits (453), Expect = 3e-47
 Identities = 99/238 (41%), Positives = 137/238 (57%), Gaps = 16/238 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFETFN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +   I  + +AGR++T ++  +L ER          E  + IKEK CY+  D  +E A
Sbjct: 186 IGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA 243


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  184 bits (448), Expect = 1e-46
 Identities = 84/84 (100%), Positives = 84/84 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDME 327
           SKRGILTLKYPIEHGIVTNWDDME
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDME 84


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score =  182 bits (443), Expect = 5e-46
 Identities = 98/238 (41%), Positives = 136/238 (57%), Gaps = 16/238 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             + G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  FDRTGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFETFN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+  +P+ EGY 
Sbjct: 126 TAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTDVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +   I  + +AGR++T  +  +L ER          E  + IKEK CY+  D  +E A
Sbjct: 186 IGSCIKHIPIAGRNITSLIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA 243


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score =  128 bits (308), Expect = 1e-29
 Identities = 71/226 (31%), Positives = 123/226 (54%), Gaps = 17/226 (7%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-------------RPRHQGVMVGMGQ 225
           +E+ ALV D G    + G+A +D+P+A  PS+VG             +  +        Q
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQ 70

Query: 226 KDSYVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 402
           +  YV     +  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA
Sbjct: 71  RKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEA 130

Query: 403 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG 582
             N + NREK+T++MFE +N PA ++   AVL+ ++SGR T +V+DSG   +  VP++EG
Sbjct: 131 SWNVRNNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEG 190

Query: 583 YALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT---AEREIVRD 711
           Y L  A+++  L G  L+    + L + G   +     A +++V++
Sbjct: 191 YVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKE 236


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score =  128 bits (308), Expect = 1e-29
 Identities = 71/226 (31%), Positives = 123/226 (54%), Gaps = 17/226 (7%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-------------RPRHQGVMVGMGQ 225
           +E+ ALV D G    + G+A +D+P+A  PS+VG             +  +        Q
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQ 70

Query: 226 KDSYVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 402
           +  YV     +  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA
Sbjct: 71  RKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEA 130

Query: 403 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG 582
             N + NREK+T++MFE +N PA ++   AVL+ ++SGR T +V+DSG   +  VP++EG
Sbjct: 131 SWNVRNNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEG 190

Query: 583 YALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT---AEREIVRD 711
           Y L  A+++  L G  L+    + L + G   +     A +++V++
Sbjct: 191 YVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKE 236


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 93.9 bits (223), Expect = 2e-19
 Identities = 63/235 (26%), Positives = 116/235 (49%), Gaps = 13/235 (5%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG++    R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 274 TLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQI 444
            L Y +  + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEI 115

Query: 445 MFETFNTPAMYVAIQAVLSLY-----ASGRTTG-----IVLDSGDGVSHTVPIYEGYALP 594
           +FE +    +Y    A L+ +     +  RTT      I++D G   +H VP   G  + 
Sbjct: 116 LFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVL 175

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             I R+D+ G+ LT+ L ++++ R        E  +V  IKE +C+VA DF+Q M
Sbjct: 176 QGIRRIDMGGKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM 228


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 93.9 bits (223), Expect = 2e-19
 Identities = 63/235 (26%), Positives = 116/235 (49%), Gaps = 13/235 (5%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG++    R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 274 TLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQI 444
            L Y +  + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEI 115

Query: 445 MFETFNTPAMYVAIQAVLSLY-----ASGRTTG-----IVLDSGDGVSHTVPIYEGYALP 594
           +FE +    +Y    A L+ +     +  RTT      I++D G   +H VP   G  + 
Sbjct: 116 LFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVL 175

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             I R+D+ G+ LT+ L ++++ R        E  +V  IKE +C+VA DF+Q M
Sbjct: 176 QGIRRIDMGGKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM 228


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 93.9 bits (223), Expect = 2e-19
 Identities = 63/235 (26%), Positives = 116/235 (49%), Gaps = 13/235 (5%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG++    R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 274 TLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQI 444
            L Y +  + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEI 115

Query: 445 MFETFNTPAMYVAIQAVLSLY-----ASGRTTG-----IVLDSGDGVSHTVPIYEGYALP 594
           +FE +    +Y    A L+ +     +  RTT      I++D G   +H VP   G  + 
Sbjct: 116 LFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVL 175

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             I R+D+ G+ LT+ L ++++ R        E  +V  IKE +C+VA DF+Q M
Sbjct: 176 QGIRRIDMGGKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM 228


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 87.0 bits (206), Expect = 3e-17
 Identities = 54/240 (22%), Positives = 112/240 (46%), Gaps = 20/240 (8%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 243
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 244 DEAQSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 414
           ++  +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLS-----LYASGRTTGIVLDSGDGVSHTVPIYE 579
              R++M +++FE +  P++   I A+ S           +  +++  G   +H +P+ +
Sbjct: 127 NFCRQQMNELLFECYGIPSVSYGIDALYSWKHHQQKQKNISDALIISFGYSTTHVIPVLD 186

Query: 580 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           G      + RL++ G  +  YL +++  +            +  +  + C++A+D+++E+
Sbjct: 187 GKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEEL 246


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 87.0 bits (206), Expect = 3e-17
 Identities = 54/240 (22%), Positives = 112/240 (46%), Gaps = 20/240 (8%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 243
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 244 DEAQSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 414
           ++  +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLS-----LYASGRTTGIVLDSGDGVSHTVPIYE 579
              R++M +++FE +  P++   I A+ S           +  +++  G   +H +P+ +
Sbjct: 127 NFCRQQMNELLFECYGIPSVSYGIDALYSWKHHQQKQKNISDALIISFGYSTTHVIPVLD 186

Query: 580 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           G      + RL++ G  +  YL +++  +            +  +  + C++A+D+++E+
Sbjct: 187 GKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEEL 246


>AF156227-1|AAD43809.1|  258|Drosophila melanogaster salivary gland
           secretion protein protein.
          Length = 258

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 461 TRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           T P CT +P   CS  +   +P   C   +TV PT  P T++T +PTP+C
Sbjct: 157 TTPLCTDTPPCTCSEESSTAIPSSPCIDTSTVIPTS-PCTQETTTPTPTC 205



 Score = 29.9 bits (64), Expect = 4.1
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 1/44 (2%)
 Frame = +2

Query: 470 PCTSPSK-PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           PCT  +  P   C+    P   C    T + T C +T  T SP+
Sbjct: 193 PCTQETTTPTPTCSTQGTPTTPCTCALTTTTTKCTTTSSTCSPS 236


>AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA
           protein.
          Length = 1286

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 461 TRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           T P CT +P   CS  +   +P   C   +TV PT  P T++T +PTP+C
Sbjct: 157 TTPLCTDTPPCTCSEESSTAIPSSPCIDTSTVIPTS-PCTQETTTPTPTC 205



 Score = 32.3 bits (70), Expect = 0.78
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = +2

Query: 458  STRPPCTS-PSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
            ST  PCTS P+    R T          T    + TPCP+T  + SPT
Sbjct: 1122 STTTPCTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTPCPTTTPSASPT 1169


>BT003608-1|AAO39611.1|  377|Drosophila melanogaster GH19274p
           protein.
          Length = 377

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 4/58 (6%)
 Frame = +2

Query: 446 CSKHSTRP-PCTSPSKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSC 607
           CS++   P PC  P  PC  C  P  PP SC +   P +  P PCP   D   P   C
Sbjct: 90  CSRNPKCPEPCCGPCGPCGPC-GPCPPPPSCGSCPPPPSCGP-PCPPPCDPCDPCDPC 145


>BT003318-1|AAO25078.1|  517|Drosophila melanogaster AT26991p
           protein.
          Length = 517

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 4/58 (6%)
 Frame = +2

Query: 446 CSKHSTRP-PCTSPSKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSC 607
           CS++   P PC  P  PC  C  P  PP SC +   P +  P PCP   D   P   C
Sbjct: 230 CSRNPKCPEPCCGPCGPCGPC-GPCPPPPSCGSCPPPPSCGP-PCPPPCDPCDPCDPC 285


>BT001317-1|AAN71072.1|  517|Drosophila melanogaster AT15066p
           protein.
          Length = 517

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 4/58 (6%)
 Frame = +2

Query: 446 CSKHSTRP-PCTSPSKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSC 607
           CS++   P PC  P  PC  C  P  PP SC +   P +  P PCP   D   P   C
Sbjct: 230 CSRNPKCPEPCCGPCGPCGPC-GPCPPPPSCGSCPPPPSCGP-PCPPPCDPCDPCDPC 285


>AE014296-204|AAN11465.1|  517|Drosophila melanogaster CG9130-PB,
           isoform B protein.
          Length = 517

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 4/58 (6%)
 Frame = +2

Query: 446 CSKHSTRP-PCTSPSKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSC 607
           CS++   P PC  P  PC  C  P  PP SC +   P +  P PCP   D   P   C
Sbjct: 230 CSRNPKCPEPCCGPCGPCGPC-GPCPPPPSCGSCPPPPSCGP-PCPPPCDPCDPCDPC 285


>AE014296-203|AAN11464.1|  517|Drosophila melanogaster CG9130-PA,
           isoform A protein.
          Length = 517

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 4/58 (6%)
 Frame = +2

Query: 446 CSKHSTRP-PCTSPSKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSC 607
           CS++   P PC  P  PC  C  P  PP SC +   P +  P PCP   D   P   C
Sbjct: 230 CSRNPKCPEPCCGPCGPCGPC-GPCPPPPSCGSCPPPPSCGP-PCPPPCDPCDPCDPC 285


>BT022491-1|AAY54907.1|  173|Drosophila melanogaster IP07937p
           protein.
          Length = 173

 Score = 36.7 bits (81), Expect = 0.036
 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 2/56 (3%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           T PPCT    PC+R   P    PP    TP   +  PC     T  P  + V T P
Sbjct: 10  TPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPCTTTPPCTPPCTTTKPCTTTVCTTP 65



 Score = 35.9 bits (79), Expect = 0.063
 Identities = 21/54 (38%), Positives = 24/54 (44%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           T PPCT    PC+R      PP     P T +P PC  T    + TP C  T P
Sbjct: 3   TPPPCTRTPPPCTR-----TPP-----PCTRTPPPCTRTPPPCTRTPPCTTTPP 46



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 5/44 (11%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSR---CTR--PVVPPVSCWTPATVSPTPCPST 577
           T PPCT    PC+R   CT   P  PP +   P T +    P +
Sbjct: 24  TPPPCTRTPPPCTRTPPCTTTPPCTPPCTTTKPCTTTVCTTPKS 67


>AE014298-1527|AAF47979.1|  592|Drosophila melanogaster CG2145-PA
           protein.
          Length = 592

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +2

Query: 458 STRPPCTSPS---KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  P   SPS    P      PV PP    + AT +PTP PS   + +PTP+
Sbjct: 243 SPTPTPGSPSAWQSPLPTPQHPVHPPTKATSAATPTPTPTPSFSSSVTPTPA 294


>AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-PA
           protein.
          Length = 926

 Score = 33.9 bits (74), Expect = 0.25
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSR-CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           TRPP   P++P +R  TRP  PP + + P T  P P  +T+    P P
Sbjct: 187 TRPPTRPPTRPPTRPPTRPPTPPPT-YLPPTNKPLPPVTTRLPPPPPP 233



 Score = 31.9 bits (69), Expect = 1.0
 Identities = 24/62 (38%), Positives = 26/62 (41%), Gaps = 11/62 (17%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWT--PATVSP---------TPCPSTKDTHSP 595
           +K  TRPP T    P  R TRP  PP    T  P T  P         TP P+   T  P
Sbjct: 509 TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPP 568

Query: 596 TP 601
           TP
Sbjct: 569 TP 570



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWT--PAT-VSPTPCPSTKDTHSPT 598
           +K  TRPP T    P  R TRP  PP    T  P T + P    +T+ T  PT
Sbjct: 406 TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPT 458



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWT--PAT-VSPTPCPSTKDTHSPT 598
           +K  TRPP T    P  R TRP  PP    T  P T + P    +T+ T  PT
Sbjct: 617 TKPPTRPPTTYLPPPSVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPT 669



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWT--PAT-VSPTPCPSTKDTHSPT 598
           +K  TRPP T    P  R TRP  PP    T  P T + P    +T+ T  PT
Sbjct: 720 TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPT 772



 Score = 30.3 bits (65), Expect = 3.1
 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWT-PATVSPTPCPSTKDTHSPTP 601
           T+PP T    P  R TRP  PP    T P T    P    + T  P P
Sbjct: 827 TKPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVVRTTRPPPP 874



 Score = 29.9 bits (64), Expect = 4.1
 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP--TPCPSTKDTHSPT 598
           TRPP T P       T   +PPV+   P    P  TP P+   T  PT
Sbjct: 287 TRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPT 334



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSC-WTPATVSP-TPCPSTKDTHSPT 598
           TRPP T P       T   +PPV+    P   SP TP P+   T  PT
Sbjct: 244 TRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPT 291



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCW--TPATVSPTPCPSTKDTHSPT 598
           T+PP T P       T    PPV+    TP    P P P+   T +PT
Sbjct: 330 TKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRASTPAPT 377



 Score = 28.7 bits (61), Expect = 9.6
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 4/50 (8%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTR----PVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           T+PP T       R TR    P  PP    TP    P P P+   T +PT
Sbjct: 539 TKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRASTPAPT 588


>AY118441-1|AAM48470.1|  961|Drosophila melanogaster SD06668p
           protein.
          Length = 961

 Score = 32.3 bits (70), Expect = 0.78
 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 450 RNIQHARHVRRHPSRALAV-RVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRS 626
           RN + +R   R  SR+  V R RS  R R+G RRR    R++ RR RT  R      SRS
Sbjct: 413 RNRRRSRSHSRSRSRSATVSRSRSGSR-RSGSRRRSRRSRSYHRRSRTRSRRRRRYYSRS 471

Query: 627 R 629
           R
Sbjct: 472 R 472


>AE014297-3591|AAS65210.1|  715|Drosophila melanogaster CG6695-PB,
           isoform B protein.
          Length = 715

 Score = 32.3 bits (70), Expect = 0.78
 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 450 RNIQHARHVRRHPSRALAV-RVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRS 626
           RN + +R   R  SR+  V R RS  R R+G RRR    R++ RR RT  R      SRS
Sbjct: 413 RNRRRSRSHSRSRSRSATVSRSRSGSR-RSGSRRRSRRSRSYHRRSRTRSRRRRRYYSRS 471

Query: 627 R 629
           R
Sbjct: 472 R 472


>AE014297-3590|AAF56321.3|  961|Drosophila melanogaster CG6695-PA,
           isoform A protein.
          Length = 961

 Score = 32.3 bits (70), Expect = 0.78
 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 450 RNIQHARHVRRHPSRALAV-RVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRS 626
           RN + +R   R  SR+  V R RS  R R+G RRR    R++ RR RT  R      SRS
Sbjct: 413 RNRRRSRSHSRSRSRSATVSRSRSGSR-RSGSRRRSRRSRSYHRRSRTRSRRRRRYYSRS 471

Query: 627 R 629
           R
Sbjct: 472 R 472


>AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-PA
           protein.
          Length = 626

 Score = 32.3 bits (70), Expect = 0.78
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 542 PATVSPTPCPSTKDTHSPTPS 604
           P T SPTP P+   +H+PTPS
Sbjct: 150 PTTPSPTPTPTLTPSHTPTPS 170


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.78
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGS 120
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>U24246-1|AAA65115.1|  393|Drosophila melanogaster I71-7 protein.
          Length = 393

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVV-PPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +T+   T+P+  C+  T P+  PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 149 CTESTTKK--TNPTCTCTESTTPLTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 204



 Score = 31.9 bits (69), Expect = 1.0
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVV-PPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +T+   T+P+  C+  T P+  PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 217 CTESTTKK--TNPTCTCTESTTPLTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 272


>U23836-4|AAA74179.1|  393|Drosophila melanogaster I71-7 protein.
          Length = 393

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVV-PPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +T+   T+P+  C+  T P+  PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 149 CTESTTKK--TNPTCTCTESTTPLTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 204



 Score = 31.9 bits (69), Expect = 1.0
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVV-PPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +T+   T+P+  C+  T P+  PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 217 CTESTTKK--TNPTCTCTESTTPLTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 272


>BT025138-1|ABE73309.1|  175|Drosophila melanogaster IP06825p
           protein.
          Length = 175

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           PP   P KP      P  P  +  T  T +PTP P+      PT +   T P
Sbjct: 63  PPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTP 114


>AY119006-1|AAM50866.1|  445|Drosophila melanogaster LP03361p
           protein.
          Length = 445

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRP-VVPPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +TR   T+P+  C+  T P   PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 149 CTESTTRK--TNPTCTCTESTTPWTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 204


>AE014296-2557|AAF49596.1|  445|Drosophila melanogaster CG7604-PA
           protein.
          Length = 445

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRP-VVPPVSCWTPATVSPTPCPSTKDTHSPT-PSCVWT 616
           C++ +TR   T+P+  C+  T P   PPV+  T    +P PC  T+ T   T P+C  T
Sbjct: 149 CTESTTRK--TNPTCTCTESTTPWTEPPVTDITTQKSNP-PCTCTESTTRKTNPTCTCT 204


>AE014296-854|AAF47906.1|  172|Drosophila melanogaster CG15023-PA
           protein.
          Length = 172

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           PP   P KP      P  P  +  T  T +PTP P+      PT +   T P
Sbjct: 60  PPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTP 111


>AY094826-1|AAM11179.1| 1266|Drosophila melanogaster LD39940p
           protein.
          Length = 1266

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 2/68 (2%)
 Frame = +3

Query: 459 QHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPR--HPASGLSRSRP 632
           Q  + +R    R    R R   + +   +++  PH A       PP   HP   L    P
Sbjct: 769 QQQQQIRTREQRRKERRERRQQQQQQQQQQQFQPHHARRHPPPPPPPQLHPPPHLHHPHP 828

Query: 633 HRLPHEDP 656
           H LPH  P
Sbjct: 829 HPLPHPHP 836


>AY051631-1|AAK93055.1|  506|Drosophila melanogaster GH28016p
           protein.
          Length = 506

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 2/68 (2%)
 Frame = +3

Query: 459 QHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPR--HPASGLSRSRP 632
           Q  + +R    R    R R   + +   +++  PH A       PP   HP   L    P
Sbjct: 9   QQQQQIRTREQRRKERRERRQQQQQQQQQQQFQPHHARRHPPPPPPPQLHPPPHLHHPHP 68

Query: 633 HRLPHEDP 656
           H LPH  P
Sbjct: 69  HPLPHPHP 76


>AL031028-1|CAA19845.2| 1795|Drosophila melanogaster EG:56G7.1
           protein.
          Length = 1795

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTK-DTHSP 595
           K +T P  T+PS      T P     S  TP+T +P+   + K  TH P
Sbjct: 567 KTTTTPSTTTPSTTTPSTTTPSTTTPSTTTPSTTTPSTTTTVKVSTHRP 615



 Score = 28.7 bits (61), Expect = 9.6
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPST-KDTHSPTPSCVWT 616
           ST  P TS + P    T P    V+  T  T   +P P+T K T +PT + V T
Sbjct: 833 STEKPITSTT-PKPSTTTPKTSTVASSTEKTTISSPKPTTEKSTENPTTNSVKT 885


>AE014298-231|AAF45644.1| 1795|Drosophila melanogaster CG14796-PA
           protein.
          Length = 1795

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTK-DTHSP 595
           K +T P  T+PS      T P     S  TP+T +P+   + K  TH P
Sbjct: 567 KTTTTPSTTTPSTTTPSTTTPSTTTPSTTTPSTTTPSTTTTVKVSTHRP 615



 Score = 28.7 bits (61), Expect = 9.6
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPST-KDTHSPTPSCVWT 616
           ST  P TS + P    T P    V+  T  T   +P P+T K T +PT + V T
Sbjct: 833 STEKPITSTT-PKPSTTTPKTSTVASSTEKTTISSPKPTTEKSTENPTTNSVKT 885


>AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-PA
           protein.
          Length = 881

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           +T PPC + + PC++ T    P     T  T +P    +T  T +PT
Sbjct: 104 TTPPPCATTTPPCTKTTTQ-TPCSGIITSTTTTPASTTTTTTTCTPT 149


>X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2
           protein C protein.
          Length = 179

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 116 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 173

Query: 549 R 551
           R
Sbjct: 174 R 174


>M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2
           protein B protein.
          Length = 226

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 163 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 220

Query: 549 R 551
           R
Sbjct: 221 R 221


>M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2
           protein A protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>M23633-1|AAA28953.1|  264|Drosophila melanogaster protein (
           D.melanogaster transformer-2 (tra-2) protein mRNA,
           complete cds. ).
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2
           protein.
          Length = 256

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 193 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 250

Query: 549 R 551
           R
Sbjct: 251 R 251


>AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p
           protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-PE,
           isoform E protein.
          Length = 179

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 116 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 173

Query: 549 R 551
           R
Sbjct: 174 R 174


>AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-PD,
           isoform D protein.
          Length = 226

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 163 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 220

Query: 549 R 551
           R
Sbjct: 221 R 221


>AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-PC,
           isoform C protein.
          Length = 226

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 163 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 220

Query: 549 R 551
           R
Sbjct: 221 R 221


>AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-PG,
           isoform G protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-PF,
           isoform F protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-PA,
           isoform A protein.
          Length = 264

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           PR      H  S  P    R D  D+ RN ++ R++RR PSR    R RSY R R+   R
Sbjct: 201 PRRGRRVYHDRSASPYDNYR-DRYDY-RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLR 258

Query: 549 R 551
           R
Sbjct: 259 R 259


>BT001711-1|AAN71466.1|  182|Drosophila melanogaster RE67695p
           protein.
          Length = 182

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 1/85 (1%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           P T + V+PP +T + S                  +  ST P  T+ S   +  T    P
Sbjct: 45  PDTTTTVTPP-STSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTP 103

Query: 524 PVSCWTPATVS-PTPCPSTKDTHSP 595
             +  TP T S  TP P++  T  P
Sbjct: 104 ATTTTTPGTTSTTTPSPNSTTTTPP 128



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--TVSPTPC-----PSTKDTHSPTPSCV 610
           K +T PP T+ ++  +  T P     S  TPA  T S TP      P T  T +P+P+  
Sbjct: 65  KTTTTPPITTSTEKTTTSTTPA-STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNST 123

Query: 611 WT*P 622
            T P
Sbjct: 124 TTTP 127


>AY118644-1|AAM50013.1|  892|Drosophila melanogaster SD03914p
           protein.
          Length = 892

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
           SPS   S  T   +PP S  TPA+ +P P P+   T
Sbjct: 652 SPSSSPSSSTVDHIPPASPATPASPAPPPSPAVAST 687


>AY071124-1|AAL48746.1|  420|Drosophila melanogaster RE17165p
           protein.
          Length = 420

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 3/49 (6%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCT--RPVVPPVSCWTPATVSPTPCPS-TKDTHSPTPS 604
           PP T P +P  + T   P  PP S   P T  P P P  T    +P PS
Sbjct: 95  PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPS 143


>AF273708-1|AAL35411.1|  118|Drosophila melanogaster
           PFTAIRE-interacting factor 2 protein.
          Length = 118

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 18/54 (33%), Positives = 21/54 (38%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           C      P CT    PC +C  P   P  C TP     TPC +   T   +P C
Sbjct: 53  CCSPCCTPCCTPCCTPCCKCCTPCCVP--CCTPCC---TPCCTPCCTPCCSPCC 101


>AE014297-3578|ABI31205.1| 1728|Drosophila melanogaster CG34100-PB,
            isoform B protein.
          Length = 1728

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +2

Query: 479  SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
            SPS   S  T   +PP S  TPA+ +P P P+   T
Sbjct: 1488 SPSSSPSSSTVDHIPPASPATPASPAPPPSPAVAST 1523


>AE014297-3577|AAN14004.2| 1918|Drosophila melanogaster CG34100-PA,
            isoform A protein.
          Length = 1918

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +2

Query: 479  SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT 586
            SPS   S  T   +PP S  TPA+ +P P P+   T
Sbjct: 1678 SPSSSPSSSTVDHIPPASPATPASPAPPPSPAVAST 1713


>AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA
           protein.
          Length = 118

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 18/54 (33%), Positives = 21/54 (38%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           C      P CT    PC +C  P   P  C TP     TPC +   T   +P C
Sbjct: 53  CCSPCCTPCCTPCCTPCCKCCTPCCVP--CCTPCC---TPCCTPCCTPCCSPCC 101


>AE014296-1719|AAN11954.1|  182|Drosophila melanogaster CG16707-PB,
           isoform B protein.
          Length = 182

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 1/85 (1%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           P T + V+PP +T + S                  +  ST P  T+ S   +  T    P
Sbjct: 45  PDTTTTVTPP-STSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTP 103

Query: 524 PVSCWTPATVS-PTPCPSTKDTHSP 595
             +  TP T S  TP P++  T  P
Sbjct: 104 ATTTTTPGTTSTTTPSPNSTTTTPP 128



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--TVSPTPC-----PSTKDTHSPTPSCV 610
           K +T PP T+ ++  +  T P     S  TPA  T S TP      P T  T +P+P+  
Sbjct: 65  KTTTTPPITTSTEKTTTSTTPA-STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNST 123

Query: 611 WT*P 622
            T P
Sbjct: 124 TTTP 127


>AE014296-1718|AAN11953.1|  182|Drosophila melanogaster CG16707-PA,
           isoform A protein.
          Length = 182

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 1/85 (1%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           P T + V+PP +T + S                  +  ST P  T+ S   +  T    P
Sbjct: 45  PDTTTTVTPP-STSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTP 103

Query: 524 PVSCWTPATVS-PTPCPSTKDTHSP 595
             +  TP T S  TP P++  T  P
Sbjct: 104 ATTTTTPGTTSTTTPSPNSTTTTPP 128



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--TVSPTPC-----PSTKDTHSPTPSCV 610
           K +T PP T+ ++  +  T P     S  TPA  T S TP      P T  T +P+P+  
Sbjct: 65  KTTTTPPITTSTEKTTTSTTPA-STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNST 123

Query: 611 WT*P 622
            T P
Sbjct: 124 TTTP 127


>AE014296-1717|AAN11952.1|  183|Drosophila melanogaster CG16707-PD,
           isoform D protein.
          Length = 183

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 1/85 (1%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           P T + V+PP +T + S                  +  ST P  T+ S   +  T    P
Sbjct: 46  PDTTTTVTPP-STSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTP 104

Query: 524 PVSCWTPATVS-PTPCPSTKDTHSP 595
             +  TP T S  TP P++  T  P
Sbjct: 105 ATTTTTPGTTSTTTPSPNSTTTTPP 129



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--TVSPTPC-----PSTKDTHSPTPSCV 610
           K +T PP T+ ++  +  T P     S  TPA  T S TP      P T  T +P+P+  
Sbjct: 66  KTTTTPPITTSTEKTTTSTTPA-STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNST 124

Query: 611 WT*P 622
            T P
Sbjct: 125 TTTP 128


>AE014296-1716|AAF50218.1|  183|Drosophila melanogaster CG16707-PC,
           isoform C protein.
          Length = 183

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 1/85 (1%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           P T + V+PP +T + S                  +  ST P  T+ S   +  T    P
Sbjct: 46  PDTTTTVTPP-STSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTP 104

Query: 524 PVSCWTPATVS-PTPCPSTKDTHSP 595
             +  TP T S  TP P++  T  P
Sbjct: 105 ATTTTTPGTTSTTTPSPNSTTTTPP 129



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--TVSPTPC-----PSTKDTHSPTPSCV 610
           K +T PP T+ ++  +  T P     S  TPA  T S TP      P T  T +P+P+  
Sbjct: 66  KTTTTPPITTSTEKTTTSTTPA-STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNST 124

Query: 611 WT*P 622
            T P
Sbjct: 125 TTTP 128


>AE014296-850|AAF47902.2|  420|Drosophila melanogaster CG15021-PA
           protein.
          Length = 420

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 3/49 (6%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCT--RPVVPPVSCWTPATVSPTPCPS-TKDTHSPTPS 604
           PP T P +P  + T   P  PP S   P T  P P P  T    +P PS
Sbjct: 95  PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPS 143


>BT025941-1|ABG02185.1|  207|Drosophila melanogaster IP14143p
           protein.
          Length = 207

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVP-PVSCWTPATVSPTPCPSTKDTHSPTPSCVW 613
           RPP   P  P +       P P +  TP T  P P PS      P    VW
Sbjct: 57  RPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVW 107



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +TRPP T+P+ P +  T    PP     P +  P P P+T     P P
Sbjct: 68  TTRPPTTTPT-PTTTPTPITTPPP---PPPSAPPPPDPATPGVWYPLP 111


>BT025938-1|ABG02182.1|  207|Drosophila melanogaster IP14043p
           protein.
          Length = 207

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVP-PVSCWTPATVSPTPCPSTKDTHSPTPSCVW 613
           RPP   P  P +       P P +  TP T  P P PS      P    VW
Sbjct: 57  RPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVW 107



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +TRPP T+P+ P +  T    PP     P +  P P P+T     P P
Sbjct: 68  TTRPPTTTPT-PTTTPTPITTPPP---PPPSAPPPPDPATPGVWYPLP 111


>BT004503-1|AAO42667.1| 2201|Drosophila melanogaster GH07949p protein.
          Length = 2201

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 2/96 (2%)
 Frame = +3

Query: 414  QGQQREDDPDHVRNIQHARH--VRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            QG+QR D PD V   +H  H  V     +   +    Y RY    RRR       +  + 
Sbjct: 2090 QGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRY----RRRLRAAEEDVEDVS 2145

Query: 588  TPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRA 695
              PR P+   +   P R   E  H    LV + RRA
Sbjct: 2146 IVPRRPSIATAPGFPVRTVPE--HTNPELVMFCRRA 2179


>AY075568-1|AAL68375.1|  806|Drosophila melanogaster SD01878p
           protein.
          Length = 806

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +3

Query: 516 SYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVH 680
           SYH  +AGL RR LP+ +H   +  P +     L     +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AY058379-1|AAL13608.1|  967|Drosophila melanogaster GH14389p protein.
          Length = 967

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 2/96 (2%)
 Frame = +3

Query: 414  QGQQREDDPDHVRNIQHARH--VRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            QG+QR D PD V   +H  H  V     +   +    Y RY    RRR       +  + 
Sbjct: 856  QGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRY----RRRLRAAEEDVEDVS 911

Query: 588  TPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRA 695
              PR P+   +   P R   E  H    LV + RRA
Sbjct: 912  IVPRRPSIATAPGFPVRTVPE--HTNPELVMFCRRA 945


>AF434683-1|AAL30427.1|  806|Drosophila melanogaster DUNC-115l
           protein.
          Length = 806

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +3

Query: 516 SYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVH 680
           SYH  +AGL RR LP+ +H   +  P +     L     +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AE014298-2950|ABC67193.1| 1456|Drosophila melanogaster CG32529-PD,
            isoform D protein.
          Length = 1456

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 2/96 (2%)
 Frame = +3

Query: 414  QGQQREDDPDHVRNIQHARH--VRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            QG+QR D PD V   +H  H  V     +   +    Y RY    RRR       +  + 
Sbjct: 1345 QGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRY----RRRLRAAEEDVEDVS 1400

Query: 588  TPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRA 695
              PR P+   +   P R   E  H    LV + RRA
Sbjct: 1401 IVPRRPSIATAPGFPVRTVPE--HTNPELVMFCRRA 1434


>AE014298-2949|AAF49024.2| 1280|Drosophila melanogaster CG32529-PC,
            isoform C protein.
          Length = 1280

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 2/96 (2%)
 Frame = +3

Query: 414  QGQQREDDPDHVRNIQHARH--VRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            QG+QR D PD V   +H  H  V     +   +    Y RY    RRR       +  + 
Sbjct: 1169 QGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRY----RRRLRAAEEDVEDVS 1224

Query: 588  TPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRA 695
              PR P+   +   P R   E  H    LV + RRA
Sbjct: 1225 IVPRRPSIATAPGFPVRTVPE--HTNPELVMFCRRA 1258


>AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-PA,
            isoform A protein.
          Length = 2529

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 2/96 (2%)
 Frame = +3

Query: 414  QGQQREDDPDHVRNIQHARH--VRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
            QG+QR D PD V   +H  H  V     +   +    Y RY    RRR       +  + 
Sbjct: 2418 QGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRY----RRRLRAAEEDVEDVS 2473

Query: 588  TPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRA 695
              PR P+   +   P R   E  H    LV + RRA
Sbjct: 2474 IVPRRPSIATAPGFPVRTVPE--HTNPELVMFCRRA 2507


>AE014297-1009|AAF54427.4|  806|Drosophila melanogaster CG31352-PA
           protein.
          Length = 806

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +3

Query: 516 SYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVH 680
           SYH  +AGL RR LP+ +H   +  P +     L     +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA
           protein.
          Length = 1118

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVP-PVSCWTPATVSPTPCPSTKDTHSPTPSCVW 613
           RPP   P  P +       P P +  TP T  P P PS      P    VW
Sbjct: 39  RPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVW 89



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +TRPP T+P+ P +  T    PP     P +  P P P+T     P P
Sbjct: 50  TTRPPTTTPT-PTTTPTPITTPPP---PPPSAPPPPDPATPGVWYPLP 93


>AE014134-456|AAF51219.1|  521|Drosophila melanogaster CG2843-PA
           protein.
          Length = 521

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 23/76 (30%), Positives = 33/76 (43%)
 Frame = +3

Query: 402 SPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRR 581
           S  P+ +QR+  P+  R  + +R   R P      R RS    +A  + +    +   RR
Sbjct: 333 SRSPEQRQRQRSPEERRERRRSRS--RSPLARRQRRTRSPEDRKARRQSKDTSKQREKRR 390

Query: 582 IRTPPRHPASGLSRSR 629
            RTP     S  SRSR
Sbjct: 391 SRTPEERSRSKRSRSR 406


>AY069587-1|AAL39732.2|  639|Drosophila melanogaster LD33388p
           protein.
          Length = 639

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 4/98 (4%)
 Frame = +3

Query: 381 PSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAG-LRRRCL 557
           P+ AH    Q    Q    P HV+      H    P+  + +         AG  +   L
Sbjct: 175 PAHAHQQHGQQPHPQSSQHPQHVKQPTITIHDTPSPTAVITISDSEDEGGEAGGAQVPVL 234

Query: 558 PHRAHLRRIRTPP--RH-PASGLSRSRPHRLPHEDPHR 662
             RAH +   +    +H P+S  SRS  H+ PH  P +
Sbjct: 235 KQRAHAQSQTSGSLLQHAPSSSCSRSSAHQQPHPHPQQ 272


>AY069099-1|AAL39244.1|  562|Drosophila melanogaster GH11670p
           protein.
          Length = 562

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 14/44 (31%), Positives = 16/44 (36%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P   P KP     +P   PV    PA     P P  K    P+P
Sbjct: 64  PKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSP 107


>AY058785-1|AAL14014.1| 1068|Drosophila melanogaster SD08329p
           protein.
          Length = 1068

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 4/98 (4%)
 Frame = +3

Query: 381 PSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAG-LRRRCL 557
           P+ AH    Q    Q    P HV+      H    P+  + +         AG  +   L
Sbjct: 605 PAHAHQQHGQQPHPQSSQHPQHVKQPTITIHDTPSPTAVITISDSEDEGGEAGGAQVPVL 664

Query: 558 PHRAHLRRIRTPP--RH-PASGLSRSRPHRLPHEDPHR 662
             RAH +   +    +H P+S  SRS  H+ PH  P +
Sbjct: 665 KQRAHAQSQTSGSLLQHAPSSSCSRSSAHQQPHPHPQQ 702


>AE014297-152|AAF52092.2| 2228|Drosophila melanogaster CG17735-PA
            protein.
          Length = 2228

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)
 Frame = -3

Query: 378  FLGGDTQLIVEGMMPNLLHVI-PVSDDSVFDGVFEGQDTSF-ALCLISYIRVLLSHTDH 208
            F+   T+L  EG+ P ++  + P    S+   V   QD S  ALC++  I  L  H DH
Sbjct: 1530 FMRKKTELWHEGIAPVVISALKPFLSSSLPADVVTVQDASLDALCMLRVIHALNRHWDH 1588


>AE014296-1574|AAF50325.2|  562|Drosophila melanogaster CG32031-PA,
           isoform A protein.
          Length = 562

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 14/44 (31%), Positives = 16/44 (36%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P   P KP     +P   PV    PA     P P  K    P+P
Sbjct: 64  PKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSP 107


>AE014296-109|AAN11444.1| 1340|Drosophila melanogaster CG17090-PB,
            isoform B protein.
          Length = 1340

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 4/98 (4%)
 Frame = +3

Query: 381  PSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAG-LRRRCL 557
            P+ AH    Q    Q    P HV+      H    P+  + +         AG  +   L
Sbjct: 876  PAHAHQQHGQQPHPQSSQHPQHVKQPTITIHDTPSPTAVITISDSEDEGGEAGGAQVPVL 935

Query: 558  PHRAHLRRIRTPP--RH-PASGLSRSRPHRLPHEDPHR 662
              RAH +   +    +H P+S  SRS  H+ PH  P +
Sbjct: 936  KQRAHAQSQTSGSLLQHAPSSSCSRSSAHQQPHPHPQQ 973


>AE014296-108|AAF47392.2| 1340|Drosophila melanogaster CG17090-PA,
            isoform A protein.
          Length = 1340

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 4/98 (4%)
 Frame = +3

Query: 381  PSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAG-LRRRCL 557
            P+ AH    Q    Q    P HV+      H    P+  + +         AG  +   L
Sbjct: 876  PAHAHQQHGQQPHPQSSQHPQHVKQPTITIHDTPSPTAVITISDSEDEGGEAGGAQVPVL 935

Query: 558  PHRAHLRRIRTPP--RH-PASGLSRSRPHRLPHEDPHR 662
              RAH +   +    +H P+S  SRS  H+ PH  P +
Sbjct: 936  KQRAHAQSQTSGSLLQHAPSSSCSRSSAHQQPHPHPQQ 973


>X01918-3|CAA25994.1|  307|Drosophila melanogaster salivary gland
           glue protein protein.
          Length = 307

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/50 (26%), Positives = 20/50 (40%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           C+  +T+PPCT+ +   +    P     +   P T S    P    T  P
Sbjct: 35  CAPRTTQPPCTTTTTTTTTTCAPPTQQSTTQPPCTTSKPTTPKQTTTQLP 84


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171 PLDRGKAPPSGRDGRYGTEGL 233
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AE014297-1861|AAF55068.1|  158|Drosophila melanogaster CG14850-PA
           protein.
          Length = 158

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 22/66 (33%), Positives = 25/66 (37%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           P GT +PA   SP       +  P        AR  RR  +R  A R R   R R   RR
Sbjct: 87  PSGTVTPAPTSSPSDSTSPSDSTPTSNNAAAVARRRRRMAARRRAQRRRRAQRRRDQRRR 146

Query: 549 RCLPHR 566
           R    R
Sbjct: 147 RAQRRR 152


>AE014296-1961|AAF50056.1|  307|Drosophila melanogaster CG11720-PA
           protein.
          Length = 307

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/50 (26%), Positives = 20/50 (40%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           C+  +T+PPCT+ +   +    P     +   P T S    P    T  P
Sbjct: 35  CAPRTTQPPCTTTTTTTTTTCAPPTQQSTTQPPCTTSKPTTPKQTTTQLP 84


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 171  PLDRGKAPPSGRDGRYGTEGL 233
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE013599-3304|AAM71024.1|  275|Drosophila melanogaster CG30401-PA,
           isoform A protein.
          Length = 275

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 527 PVVRPDAYSESTAWMATYMAGVLN 456
           P+V PD+  + +AW+  + AG+LN
Sbjct: 154 PMVSPDSEQQMSAWLHIFNAGILN 177


>AE013599-3303|AAM71023.1|  377|Drosophila melanogaster CG30401-PB,
           isoform B protein.
          Length = 377

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 527 PVVRPDAYSESTAWMATYMAGVLN 456
           P+V PD+  + +AW+  + AG+LN
Sbjct: 256 PMVSPDSEQQMSAWLHIFNAGILN 279


>BT029931-1|ABM92805.1|  750|Drosophila melanogaster IP11737p
           protein.
          Length = 750

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/88 (25%), Positives = 32/88 (36%), Gaps = 2/88 (2%)
 Frame = +3

Query: 423 QREDDPDHVRNI-QHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPR 599
           Q++  P +  ++ QH  H++ HP  ALA     +    A   R  +    H     T P 
Sbjct: 622 QQQMHPQYQYHVHQHQNHLQTHPLAALANTSGPFGGTLASSARDYVDGLHHAAHSHTHPH 681

Query: 600 -HPASGLSRSRPHRLPHEDPHRARLLVH 680
            HP      S     PH   H  +   H
Sbjct: 682 SHPHHSSHHSHHTAYPHSHSHHQQQQPH 709


>BT003320-1|AAO25080.1|  798|Drosophila melanogaster AT11823p
           protein.
          Length = 798

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           QP G+ R+          H  H  RHP +    +   +   R+G R+RC    A   RI+
Sbjct: 379 QPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHPHRTTRSG-RKRCSLEAADPERIQ 437


>AY069512-1|AAL39657.1|  857|Drosophila melanogaster LD23217p
           protein.
          Length = 857

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +3

Query: 597 RHPASGLSRSRPHRLPHEDPH 659
           R P  G S+S PH  PH  PH
Sbjct: 86  RSPPHGNSKSHPHAHPHHPPH 106


>AY069429-1|AAL39574.1|  479|Drosophila melanogaster LD13887p
           protein.
          Length = 479

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +3

Query: 582 IRTPPRHPASGLSRSRPHRLPHEDPH 659
           ++ P  HP      S PH LPH  PH
Sbjct: 335 LQHPHTHPHPHAQHSHPHTLPHSLPH 360


>AY069327-1|AAL39472.2|  552|Drosophila melanogaster LD04591p
           protein.
          Length = 552

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           QP G+ R+          H  H  RHP +    +   +   R+G R+RC    A   RI+
Sbjct: 133 QPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHPHRTTRSG-RKRCSLEAADPERIQ 191


>AE014298-1231|AAS65293.1| 1006|Drosophila melanogaster CG12075-PB,
           isoform B protein.
          Length = 1006

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +3

Query: 597 RHPASGLSRSRPHRLPHEDPH 659
           R P  G S+S PH  PH  PH
Sbjct: 235 RSPPHGNSKSHPHAHPHHPPH 255


>AE014298-1230|AAF46414.3| 1006|Drosophila melanogaster CG12075-PA,
           isoform A protein.
          Length = 1006

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +3

Query: 597 RHPASGLSRSRPHRLPHEDPH 659
           R P  G S+S PH  PH  PH
Sbjct: 235 RSPPHGNSKSHPHAHPHHPPH 255


>AE014298-609|AAF45927.1| 1357|Drosophila melanogaster CG15570-PA
            protein.
          Length = 1357

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +2

Query: 476  TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
            T+ +  CS  T  V P  S     T SPT  P+   T SPT
Sbjct: 1209 TNVANDCSGKTTTVAPTQSPTESPTESPTGSPTDSPTQSPT 1249


>AE014297-4076|AAF56673.2|  980|Drosophila melanogaster CG6051-PA
           protein.
          Length = 980

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           QP G+ R+          H  H  RHP +    +   +   R+G R+RC    A   RI+
Sbjct: 561 QPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHPHRTTRSG-RKRCSLEAADPERIQ 619


>AE014296-1669|AAF50260.2|  783|Drosophila melanogaster CG32043-PB,
           isoform B protein.
          Length = 783

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +3

Query: 582 IRTPPRHPASGLSRSRPHRLPHEDPH 659
           ++ P  HP      S PH LPH  PH
Sbjct: 639 LQHPHTHPHPHAQHSHPHTLPHSLPH 664


>AE014296-1668|AAF50261.2|  783|Drosophila melanogaster CG32043-PA,
           isoform A protein.
          Length = 783

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +3

Query: 582 IRTPPRHPASGLSRSRPHRLPHEDPH 659
           ++ P  HP      S PH LPH  PH
Sbjct: 639 LQHPHTHPHPHAQHSHPHTLPHSLPH 664


>AE013599-873|AAF58931.1|  466|Drosophila melanogaster CG12932-PA
           protein.
          Length = 466

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 22/88 (25%), Positives = 32/88 (36%), Gaps = 2/88 (2%)
 Frame = +3

Query: 423 QREDDPDHVRNI-QHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPR 599
           Q++  P +  ++ QH  H++ HP  ALA     +    A   R  +    H     T P 
Sbjct: 338 QQQMHPQYQYHVHQHQNHLQTHPLAALANTSGPFGGTLASSARDYVDGLHHAAHSHTHPH 397

Query: 600 -HPASGLSRSRPHRLPHEDPHRARLLVH 680
            HP      S     PH   H  +   H
Sbjct: 398 SHPHHSSHHSHHTAYPHSHSHHQQQQPH 425


>Y12322-1|CAA72991.1| 1191|Drosophila melanogaster u-shaped protein.
          Length = 1191

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +2

Query: 455 HSTRPPCTSPSKP--CSRCTRPVVPPVSCWTPATVSPTPCPSTK 580
           +S   P  SPS P    +  +P  PP         SP+PCP+ K
Sbjct: 108 NSPSTPPRSPSSPQLIPKLEQPATPPSEPEASPCPSPSPCPTPK 151


>M27431-1|AAA28868.1| 1896|Drosophila melanogaster protein (
            D.melanogaster RpII215gene encoding RNA polymerase II,
            largest subunit, completecds. ).
          Length = 1896

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455  HSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP 601
            +S   P  SP+ PC   T P   P S  +TP T S +P   T   +S +P
Sbjct: 1694 YSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSP---TSPNYSASP 1740


>M19537-1|AAA28827.1|  408|Drosophila melanogaster RNA polymerase II
           largest subunit protein.
          Length = 408

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP 601
           +S   P  SP+ PC   T P   P S  +TP T S +P   T   +S +P
Sbjct: 213 YSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSP---TSPNYSASP 259


>BT015278-1|AAT94507.1| 1191|Drosophila melanogaster LD12631p
           protein.
          Length = 1191

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +2

Query: 455 HSTRPPCTSPSKP--CSRCTRPVVPPVSCWTPATVSPTPCPSTK 580
           +S   P  SPS P    +  +P  PP         SP+PCP+ K
Sbjct: 108 NSPSTPPRSPSSPQLIPKLEQPATPPSEPEASPCPSPSPCPTPK 151


>BT011434-1|AAR99092.1|  765|Drosophila melanogaster RH61815p
           protein.
          Length = 765

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +3

Query: 366 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVR 515
           R RG P PA  G+ + +  + +     ++ +QH  H   HP R  A+ ++
Sbjct: 545 RARGQPQPAQGGAQRGESVRVQAVRQALQALQHPVHPPAHPQRHAALSLQ 594


>AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p
           protein.
          Length = 1272

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC-PSTKDTHSPTP 601
           S+ S+ PP   P+ P      P  P +S   PA+ SP+P  P   +  +P P
Sbjct: 298 SRSSSLPP---PASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAPAP 346


>AY089555-1|AAL90293.1| 1429|Drosophila melanogaster LD43558p protein.
          Length = 1429

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455  HSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP 601
            +S   P  SP+ PC   T P   P S  +TP T S +P   T   +S +P
Sbjct: 1234 YSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSP---TSPNYSASP 1280


>AE014298-1637|AAF48057.1| 1887|Drosophila melanogaster CG1554-PA
            protein.
          Length = 1887

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455  HSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP 601
            +S   P  SP+ PC   T P   P S  +TP T S +P   T   +S +P
Sbjct: 1692 YSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSP---TSPNYSASP 1738


>AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA
            protein.
          Length = 3539

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +2

Query: 449  SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC-PSTKDTHSPTP 601
            S+ S+ PP   P+ P      P  P +S   PA+ SP+P  P   +  +P P
Sbjct: 2565 SRSSSLPP---PASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAPAP 2613


>AE014134-116|AAF51488.2| 1191|Drosophila melanogaster CG2762-PA
           protein.
          Length = 1191

 Score = 28.7 bits (61), Expect = 9.6
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +2

Query: 455 HSTRPPCTSPSKP--CSRCTRPVVPPVSCWTPATVSPTPCPSTK 580
           +S   P  SPS P    +  +P  PP         SP+PCP+ K
Sbjct: 108 NSPSTPPRSPSSPQLIPKLEQPATPPSEPEASPCPSPSPCPTPK 151


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,530,499
Number of Sequences: 53049
Number of extensions: 1048902
Number of successful extensions: 5238
Number of sequences better than 10.0: 151
Number of HSP's better than 10.0 without gapping: 4062
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5108
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3654740856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).