SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription ...    33   0.56 
BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p pro...    33   0.56 
BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p pro...    33   0.56 
AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA...    33   0.56 
AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC...    33   0.56 
AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB...    33   0.56 
AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcripti...    33   0.56 
AY058674-1|AAL13903.1|  523|Drosophila melanogaster LD38433p pro...    30   3.9  
AE014297-3808|AAF56474.1|  523|Drosophila melanogaster CG5112-PA...    30   3.9  
AF257740-1|AAF68026.1|   88|Drosophila melanogaster unknown prot...    30   5.2  

>S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription
            factor TFIID 230kda subunit protein.
          Length = 2068

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1335 SPSRKKFKLKPDLKLKCGAC 1354


>BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p protein.
          Length = 1964

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p protein.
          Length = 2096

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA,
            isoform A protein.
          Length = 2065

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC,
            isoform C protein.
          Length = 2098

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB,
            isoform B protein.
          Length = 2129

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcription
            factor protein.
          Length = 2065

 Score = 33.1 bits (72), Expect = 0.56
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 556  TPSRRRAKLKPDLKLKVSVC 615
            +PSR++ KLKPDLKLK   C
Sbjct: 1332 SPSRKKFKLKPDLKLKCGAC 1351


>AY058674-1|AAL13903.1|  523|Drosophila melanogaster LD38433p
           protein.
          Length = 523

 Score = 30.3 bits (65), Expect = 3.9
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = +1

Query: 475 MFCSGDLGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVSVCKVLSACSYFHTQI 654
           M C+G +  S+ +L+P+ Q+  EP L      +AKLK D K+ +   +     S    Q 
Sbjct: 265 MVCAGPMSRSARDLLPMMQVLVEPSL------KAKLKLDQKVDLKRLRYFYVSSNGMAQC 318

Query: 655 TRHVRSTSKV 684
               R T +V
Sbjct: 319 NPINRETERV 328


>AE014297-3808|AAF56474.1|  523|Drosophila melanogaster CG5112-PA
           protein.
          Length = 523

 Score = 30.3 bits (65), Expect = 3.9
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = +1

Query: 475 MFCSGDLGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVSVCKVLSACSYFHTQI 654
           M C+G +  S+ +L+P+ Q+  EP L      +AKLK D K+ +   +     S    Q 
Sbjct: 265 MVCAGPMSRSARDLLPMMQVLVEPSL------KAKLKLDQKVDLKRLRYFYVSSNGMAQC 318

Query: 655 TRHVRSTSKV 684
               R T +V
Sbjct: 319 NPINRETERV 328


>AF257740-1|AAF68026.1|   88|Drosophila melanogaster unknown
           protein.
          Length = 88

 Score = 29.9 bits (64), Expect = 5.2
 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = +1

Query: 796 RRCSKAY--IMGKNPLYDMIRPETFEKTQIKKYTLGTY 903
           R C+ AY  I   NP    IR  TF   QIKKY    Y
Sbjct: 48  RSCNAAYFPIKQNNPTTRRIRQGTFNHNQIKKYACEKY 85


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 43,959,827
Number of Sequences: 53049
Number of extensions: 930604
Number of successful extensions: 1887
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1811
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1887
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4587341472
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).