SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY058611-1|AAL13840.1|  521|Drosophila melanogaster LD30573p pro...    36   0.053
AE014297-667|AAF54161.1|  915|Drosophila melanogaster CG2943-PA ...    36   0.053
AY069844-1|AAL39989.1|  944|Drosophila melanogaster SD09109p pro...    31   2.0  
AY069645-1|AAL39790.1|  753|Drosophila melanogaster LD41184p pro...    31   2.0  
AE014134-1018|AAN10570.1|  753|Drosophila melanogaster CG9098-PB...    31   2.0  
AE014134-1017|AAF52322.2|  944|Drosophila melanogaster CG9098-PA...    31   2.0  

>AY058611-1|AAL13840.1|  521|Drosophila melanogaster LD30573p
           protein.
          Length = 521

 Score = 36.3 bits (80), Expect = 0.053
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -1

Query: 830 YYHSTAGKLANHI*SYK*KKPNLVKFIATTPDGRFKYYLNLFSIT*MLCAVSVIKKITKN 651
           + HS    L +    YK   PNLV F+   PD   K  LNL+ +   + + SV+  +T  
Sbjct: 247 HVHSQGRVLGDRSVLYKYINPNLVAFVTQAPDSTHKSVLNLYLVD--VVSGSVVFTMTHR 304

Query: 650 KIQLLL*I--SLNDLTYKKLRSSNLKHSGVTSV 558
           K++  L I  S N L Y    +  L+ + +T++
Sbjct: 305 KVRAPLSIVHSENWLAYSYF-NEKLRRTEITTI 336


>AE014297-667|AAF54161.1|  915|Drosophila melanogaster CG2943-PA
           protein.
          Length = 915

 Score = 36.3 bits (80), Expect = 0.053
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -1

Query: 830 YYHSTAGKLANHI*SYK*KKPNLVKFIATTPDGRFKYYLNLFSIT*MLCAVSVIKKITKN 651
           + HS    L +    YK   PNLV F+   PD   K  LNL+ +   + + SV+  +T  
Sbjct: 641 HVHSQGRVLGDRSVLYKYINPNLVAFVTQAPDSTHKSVLNLYLVD--VVSGSVVFTMTHR 698

Query: 650 KIQLLL*I--SLNDLTYKKLRSSNLKHSGVTSV 558
           K++  L I  S N L Y    +  L+ + +T++
Sbjct: 699 KVRAPLSIVHSENWLAYSYF-NEKLRRTEITTI 730


>AY069844-1|AAL39989.1|  944|Drosophila melanogaster SD09109p
           protein.
          Length = 944

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = +3

Query: 177 VLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTP 347
           +LA   GLSPLNSP   G  G    G       +     Q+  SP  G P  P  +P
Sbjct: 361 MLAGLRGLSPLNSPM--GSNGAVGAGMNATFRFEPQQQQQQQLSPMAGSPASPHCSP 415


>AY069645-1|AAL39790.1|  753|Drosophila melanogaster LD41184p
           protein.
          Length = 753

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = +3

Query: 177 VLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTP 347
           +LA   GLSPLNSP   G  G    G       +     Q+  SP  G P  P  +P
Sbjct: 170 MLAGLRGLSPLNSPM--GSNGAVGAGMNATFRFEPQQQQQQQLSPMAGSPASPHCSP 224


>AE014134-1018|AAN10570.1|  753|Drosophila melanogaster CG9098-PB,
           isoform B protein.
          Length = 753

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = +3

Query: 177 VLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTP 347
           +LA   GLSPLNSP   G  G    G       +     Q+  SP  G P  P  +P
Sbjct: 170 MLAGLRGLSPLNSPM--GSNGAVGAGMNATFRFEPQQQQQQQLSPMAGSPASPHCSP 224


>AE014134-1017|AAF52322.2|  944|Drosophila melanogaster CG9098-PA,
           isoform A protein.
          Length = 944

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = +3

Query: 177 VLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTP 347
           +LA   GLSPLNSP   G  G    G       +     Q+  SP  G P  P  +P
Sbjct: 361 MLAGLRGLSPLNSPM--GSNGAVGAGMNATFRFEPQQQQQQQLSPMAGSPASPHCSP 415


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,129,170
Number of Sequences: 53049
Number of extensions: 749434
Number of successful extensions: 2368
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 2177
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2359
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4085918148
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).