SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE...    49   1e-05
AE014296-1090|AAF50681.2|  991|Drosophila melanogaster CG10289-P...    36   0.11 
AY061576-1|AAL29124.1|  987|Drosophila melanogaster SD02803p pro...    34   0.35 
AL021726-1|CAA16809.1| 1002|Drosophila melanogaster EG:171E4.1,F...    33   0.46 
X86683-1|CAA60382.1| 1002|Drosophila melanogaster deep orange (d...    33   0.80 
AY061592-1|AAL29140.1| 1002|Drosophila melanogaster SD04291p pro...    33   0.80 
AE014298-240|AAF45652.1| 1002|Drosophila melanogaster CG3093-PA ...    33   0.80 
AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA...    32   1.1  
X17495-1|CAA35530.1|  406|Drosophila melanogaster otefin protein.      32   1.4  
AY060612-1|AAL28160.1|  321|Drosophila melanogaster GH03873p pro...    32   1.4  
AE014298-2618|AAN09595.1|  321|Drosophila melanogaster CG15814-P...    32   1.4  
AE014298-2617|AAN09594.1|  321|Drosophila melanogaster CG15814-P...    32   1.4  
AE014298-2616|AAF48770.1|  321|Drosophila melanogaster CG15814-P...    32   1.4  
AY051940-1|AAK93364.1|  424|Drosophila melanogaster LD41911p pro...    31   1.8  
AE013599-2651|AAF57722.3|  424|Drosophila melanogaster CG5581-PA...    31   1.8  
AY118607-1|AAM49976.1|  676|Drosophila melanogaster LP07116p pro...    31   2.4  
AE014297-4040|AAF56648.1|  676|Drosophila melanogaster CG6296-PA...    31   2.4  
AE014298-2322|AAN09382.3| 16223|Drosophila melanogaster CG32580-...    30   4.2  
BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p pro...    30   5.6  
AY864359-1|AAX37997.1|  519|Drosophila melanogaster hemomucin pr...    30   5.6  
AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA...    30   5.6  
AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-P...    29   7.4  

>AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE,
            isoform E protein.
          Length = 9606

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 3/74 (4%)
 Frame = +2

Query: 539  NSTYLSMDLPGGICSWKDHSSYLS--AETPSDSLDSNAEALQASATEDILT-TLPTEPVV 709
            +S Y S DLPGG+  W+D S+YL+  AE P   L+S   A   S  E +LT T  T P  
Sbjct: 9295 SSEYRSTDLPGGVGHWRDDSTYLALEAEQPQVKLESVPLAPTISGVESVLTETNTTSPAP 9354

Query: 710  QTPPLQEPAINETT 751
               P+  P  + +T
Sbjct: 9355 APDPVTAPETSPST 9368



 Score = 29.9 bits (64), Expect = 5.6
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 9/101 (8%)
 Frame = +2

Query: 692  PTEPVVQTPPLQEPAINETTRRTPKDD-----LSND----IETLLVEIRDVQTRLTDLPD 844
            PTEP V +  + E   N+  + + KD      L N     IET +VEI   Q  +T+   
Sbjct: 1728 PTEPEVISEVVVEQEQNKPQKPSRKDKKKQKLLENQPETVIETKVVEIVKPQQEITEPQT 1787

Query: 845  ESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQT 967
            E  E     S   ++ NQ   S +   ++D G+     ++T
Sbjct: 1788 EITEPLNTTSAITTDNNQTVSSEQTTVSDDSGLIKTTVIRT 1828


>AE014296-1090|AAF50681.2|  991|Drosophila melanogaster CG10289-PA
           protein.
          Length = 991

 Score = 35.5 bits (78), Expect = 0.11
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +2

Query: 734 AINETTRRTP-KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           A+N+  R    KD+   DIE   +E+   Q      PDE   A EE    E + +QV  +
Sbjct: 463 ALNDAKRAEGGKDEEGGDIE---IEVAAAQEVAAQTPDERQTAAEENQEHEEHMSQVEAA 519

Query: 911 SRAVGAED 934
           + A  +ED
Sbjct: 520 AEATASED 527


>AY061576-1|AAL29124.1|  987|Drosophila melanogaster SD02803p
           protein.
          Length = 987

 Score = 33.9 bits (74), Expect = 0.35
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +2

Query: 734 AINETTRRTP-KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           A+N+  R    KD+   DIE   +E+   Q      PDE   A EE    + +  QV  +
Sbjct: 462 ALNDAKRAEGGKDEEGGDIE---IEVAAAQEVAAQTPDERQAAAEENQEHKEHMGQVEAA 518

Query: 911 SRAVGAEDHGVPPEVEVQTLIKNS 982
           + A  +ED    P+V+    +KN+
Sbjct: 519 AEATASED--AEPKVQ-DNEVKNN 539


>AL021726-1|CAA16809.1| 1002|Drosophila melanogaster
           EG:171E4.1,FBgn0000482;dor protein.
          Length = 1002

 Score = 33.5 bits (73), Expect = 0.46
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           + + N  E +   +RD   R+ +L  E  E TE+  R  +   Q+R+ S  V ++D
Sbjct: 828 EKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRATAELQQLRQHSLTVESQD 883


>X86683-1|CAA60382.1| 1002|Drosophila melanogaster deep orange (dor)
           protein.
          Length = 1002

 Score = 32.7 bits (71), Expect = 0.80
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           + + N  E +   +RD   R+ +L  E  E TE+  R  +   Q+R+ S  V ++D
Sbjct: 828 EKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQD 883


>AY061592-1|AAL29140.1| 1002|Drosophila melanogaster SD04291p
           protein.
          Length = 1002

 Score = 32.7 bits (71), Expect = 0.80
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           + + N  E +   +RD   R+ +L  E  E TE+  R  +   Q+R+ S  V ++D
Sbjct: 828 EKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQD 883


>AE014298-240|AAF45652.1| 1002|Drosophila melanogaster CG3093-PA
           protein.
          Length = 1002

 Score = 32.7 bits (71), Expect = 0.80
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           + + N  E +   +RD   R+ +L  E  E TE+  R  +   Q+R+ S  V ++D
Sbjct: 828 EKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQD 883


>AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA
           protein.
          Length = 1183

 Score = 32.3 bits (70), Expect = 1.1
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 6/97 (6%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATE------EV 871
           QTPP +E    ++  ++ K + S  ++ LLVE    ++   +L DE  EA +      +V
Sbjct: 646 QTPPTKEGTFIKSPTQSAKSEKSGQMDNLLVE----ESHAVELTDEEQEAAKSVVTQVDV 701

Query: 872 SRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTLIKNS 982
                     + S  A  AE++G   E E +  ++ S
Sbjct: 702 HHDAEEIQTSKSSEEAPQAEENGKEKESEQEVKLQLS 738


>X17495-1|CAA35530.1|  406|Drosophila melanogaster otefin protein.
          Length = 406

 Score = 31.9 bits (69), Expect = 1.4
 Identities = 29/114 (25%), Positives = 42/114 (36%), Gaps = 1/114 (0%)
 Frame = +2

Query: 596 SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTP-PLQEPAINETTRRTPKDD 772
           S+  +A TP D LD N  A    A   I      EPV + P         E  R  P++ 
Sbjct: 54  SAPAAASTPVDKLDGNKVAPATKARRTITAAEAKEPVRRLPEEAVRRRPEEADRLRPEEP 113

Query: 773 LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           ++    T     + VQTR +     S     E  R+     +   SS+    E+
Sbjct: 114 VAARKPTTASAAQPVQTRRSSTSSGSERKVVEPLRKPETIVEQPASSKRADREE 167


>AY060612-1|AAL28160.1|  321|Drosophila melanogaster GH03873p
           protein.
          Length = 321

 Score = 31.9 bits (69), Expect = 1.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDA 373
           +++    +P+DLN   D     E +R  ++  VEKH  HDA
Sbjct: 3   QEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDA 43


>AE014298-2618|AAN09595.1|  321|Drosophila melanogaster CG15814-PC,
           isoform C protein.
          Length = 321

 Score = 31.9 bits (69), Expect = 1.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDA 373
           +++    +P+DLN   D     E +R  ++  VEKH  HDA
Sbjct: 3   QEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDA 43


>AE014298-2617|AAN09594.1|  321|Drosophila melanogaster CG15814-PB,
           isoform B protein.
          Length = 321

 Score = 31.9 bits (69), Expect = 1.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDA 373
           +++    +P+DLN   D     E +R  ++  VEKH  HDA
Sbjct: 3   QEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDA 43


>AE014298-2616|AAF48770.1|  321|Drosophila melanogaster CG15814-PA,
           isoform A protein.
          Length = 321

 Score = 31.9 bits (69), Expect = 1.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDA 373
           +++    +P+DLN   D     E +R  ++  VEKH  HDA
Sbjct: 3   QEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDA 43


>AY051940-1|AAK93364.1|  424|Drosophila melanogaster LD41911p
           protein.
          Length = 424

 Score = 31.5 bits (68), Expect = 1.8
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 4/118 (3%)
 Frame = +2

Query: 596 SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAI----NETTRRTP 763
           S+  +A TP D LD N  A    A   I      EPV + P   E AI    +E  R   
Sbjct: 72  SAPAAASTPVDKLDGNKVAPATKARRTITAAEAKEPVRRLP---EEAIRRRPDEADRLRS 128

Query: 764 KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDH 937
           ++ ++    T     + VQTR T     S     E  R+     +   SS+    E++
Sbjct: 129 EEPVAARKPTTAPAAQPVQTRRTSTSSGSERKVVEPLRKPETIVEQPASSKRADREEN 186


>AE013599-2651|AAF57722.3|  424|Drosophila melanogaster CG5581-PA
           protein.
          Length = 424

 Score = 31.5 bits (68), Expect = 1.8
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 4/118 (3%)
 Frame = +2

Query: 596 SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAI----NETTRRTP 763
           S+  +A TP D LD N  A    A   I      EPV + P   E AI    +E  R   
Sbjct: 72  SAPAAASTPVDKLDGNKVAPATKARRTITAAEAKEPVRRLP---EEAIRRRPDEADRLRS 128

Query: 764 KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDH 937
           ++ ++    T     + VQTR T     S     E  R+     +   SS+    E++
Sbjct: 129 EEPVAARKPTTAPAAQPVQTRRTSTSSGSERKVVEPLRKPETIVEQPASSKRADREEN 186


>AY118607-1|AAM49976.1|  676|Drosophila melanogaster LP07116p
           protein.
          Length = 676

 Score = 31.1 bits (67), Expect = 2.4
 Identities = 30/118 (25%), Positives = 47/118 (39%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
           +PSD+ DS  E  +   T    T  P EP   T    E +  E    +  ++   +  T 
Sbjct: 530 SPSDADDSTTEEPEEDTTT---TKKPVEPSTTTEE-PEDSTTEVPEESTTEEPDKETSTT 585

Query: 797 LVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTL 970
             E  +V T +    D +++   + S RE   +    +         GVPPEV + TL
Sbjct: 586 NAE-PEVTTTVEPDVDSTVDPEGDQSTREDLEDVSTTAVPTKLPSTTGVPPEVPITTL 642


>AE014297-4040|AAF56648.1|  676|Drosophila melanogaster CG6296-PA
           protein.
          Length = 676

 Score = 31.1 bits (67), Expect = 2.4
 Identities = 30/118 (25%), Positives = 47/118 (39%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
           +PSD+ DS  E  +   T    T  P EP   T    E +  E    +  ++   +  T 
Sbjct: 530 SPSDADDSTTEEPEEDTTT---TKKPVEPSTTTEE-PEDSTTEVPEESTTEEPDKETSTT 585

Query: 797 LVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTL 970
             E  +V T +    D +++   + S RE   +    +         GVPPEV + TL
Sbjct: 586 NAE-PEVTTTVEPDVDSTVDPEGDQSTREDLEDVSTTAVPTKLPSTTGVPPEVPITTL 642


>AE014298-2322|AAN09382.3| 16223|Drosophila melanogaster CG32580-PA
           protein.
          Length = 16223

 Score = 30.3 bits (65), Expect = 4.2
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATE-----DILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSN 781
           T SD+ + N++    ++TE     ++ TT+P E  ++   L E  + +    TPK   + 
Sbjct: 451 TFSDAPEPNSDITGYTSTECIKCSELTTTVPIETTIERTKLSETPLQKLQFSTPKKSTNR 510

Query: 782 DIETL-LVEIRDVQTRLTDLPDESLEATEEVSRRE 883
               L L  + D   ++ +   +  +  EE S  E
Sbjct: 511 FASVLQLNAVTDSSIKVLNTKTDQFDTEEETSLSE 545


>BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p
           protein.
          Length = 882

 Score = 29.9 bits (64), Expect = 5.6
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = +2

Query: 590 DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
           +   Y SAE   D+L++N    Q +  E I+TT+    V QTPP      N   R     
Sbjct: 592 ERDRYPSAEQHDDALNNNHSHAQDNIMEPIITTI----VPQTPPPSTHNNNFKIRLVESH 647

Query: 770 DLSND 784
            L+N+
Sbjct: 648 HLTNN 652


>AY864359-1|AAX37997.1|  519|Drosophila melanogaster hemomucin
           protein.
          Length = 519

 Score = 29.9 bits (64), Expect = 5.6
 Identities = 18/68 (26%), Positives = 28/68 (41%)
 Frame = +2

Query: 668 TEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDE 847
           T    TT   +P    PP  +P+   TT  TPK   +    T   E    Q + T +P++
Sbjct: 450 TTTTTTTTTPKPTTTKPPTAKPSTTTTTTTTPKPTTTTTPTTPTPEPSKPQVKRT-VPEK 508

Query: 848 SLEATEEV 871
                E++
Sbjct: 509 PAPVEEDI 516


>AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA
           protein.
          Length = 943

 Score = 29.9 bits (64), Expect = 5.6
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = +2

Query: 590 DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
           +   Y SAE   D+L++N    Q +  E I+TT+    V QTPP      N   R     
Sbjct: 653 ERDRYPSAEQHDDALNNNHSHAQDNIMEPIITTI----VPQTPPPSTHNNNFKIRLVESH 708

Query: 770 DLSND 784
            L+N+
Sbjct: 709 HLTNN 713


>AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-PH,
            isoform H protein.
          Length = 8805

 Score = 29.5 bits (63), Expect = 7.4
 Identities = 24/108 (22%), Positives = 48/108 (44%)
 Frame = +2

Query: 662  SATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLP 841
            S++E+ L    T  V +TP L EP  +        +  +ND +    EI D + + T+  
Sbjct: 3318 SSSEETLPQENTATVKETP-LNEPVPSSPAETKEIEQTTNDDQKKPEEIVDTEKKTTEQK 3376

Query: 842  DESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTLIKNSS 985
                  TE +S  E+    V  +++    ++  + P  +++ +I+  S
Sbjct: 3377 PVETIPTEPISTSET--TTVTLTTKTTIVDEGKLHPPSDIEQIIQPHS 3422


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,124,833
Number of Sequences: 53049
Number of extensions: 756794
Number of successful extensions: 3629
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 3250
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3627
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4955967126
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).