SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT009984-1|AAQ22453.1|  329|Drosophila melanogaster RE52350p pro...   194   1e-49
AE014296-2613|AAF49553.2|  329|Drosophila melanogaster CG5830-PA...   194   1e-49
AY094776-1|AAM11129.1|  243|Drosophila melanogaster LD04380p pro...    75   7e-14
AE014298-3113|AAF50833.1|  243|Drosophila melanogaster CG1696-PA...    75   7e-14
BT022639-1|AAY55055.1|  253|Drosophila melanogaster IP07723p pro...    62   1e-09
AE014296-614|AAF47748.2|  253|Drosophila melanogaster CG12078-PA...    62   1e-09
AY089227-1|AAL89965.1|  293|Drosophila melanogaster AT02326p pro...    60   4e-09
AE013599-696|AAF59057.2|  293|Drosophila melanogaster CG8584-PA ...    60   4e-09
AE014296-72|AAF47370.1|  409|Drosophila melanogaster CG12313-PA ...    52   6e-07
AY070535-1|AAL48006.1|  428|Drosophila melanogaster LD05179p pro...    51   2e-06
AE014298-458|AAF45820.2|  428|Drosophila melanogaster CG2713-PA ...    51   2e-06
AY122238-1|AAM52750.1|  896|Drosophila melanogaster SD01014p pro...    47   3e-05
AE013599-3903|AAF47230.1|  880|Drosophila melanogaster CG12252-P...    47   3e-05
AL021728-7|CAA16816.1|  415|Drosophila melanogaster EG:95B7.3 pr...    44   2e-04
AY089295-1|AAL90033.1|  172|Drosophila melanogaster AT08867p pro...    36   0.073
AJ130871-1|CAA10224.1| 1464|Drosophila melanogaster Bazooka prot...    32   0.90 
AF203342-1|AAF13280.1| 1729|Drosophila melanogaster pericardine ...    32   0.90 
AE014298-2531|ABI30988.1| 1520|Drosophila melanogaster CG5055-PB...    32   0.90 
AE014298-2530|AAF48703.1| 1464|Drosophila melanogaster CG5055-PA...    32   0.90 
BT009991-1|AAQ22460.1| 1071|Drosophila melanogaster RE39441p pro...    31   1.2  
AE014296-2068|AAF49980.2| 1713|Drosophila melanogaster CG5700-PB...    31   1.2  
AY118321-1|AAM48350.1|  111|Drosophila melanogaster LD08201p pro...    31   2.1  
BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p pro...    29   4.8  
AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-P...    29   4.8  
AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-P...    29   4.8  
AY119139-1|AAM50999.1|  615|Drosophila melanogaster RE41430p pro...    29   8.4  
AE014298-1780|AAF48175.2|  615|Drosophila melanogaster CG11138-P...    29   8.4  
AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P...    29   8.4  
AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P...    29   8.4  
AE014296-988|AAN12103.1|  460|Drosophila melanogaster CG32414-PA...    29   8.4  

>BT009984-1|AAQ22453.1|  329|Drosophila melanogaster RE52350p
           protein.
          Length = 329

 Score =  194 bits (472), Expect = 1e-49
 Identities = 88/106 (83%), Positives = 97/106 (91%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  MVIDLDETLVHSSFKPI NA F+VPVEIDG VHQVYVLKRPHVDEFL++ GELY CV
Sbjct: 89  RKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECV 148

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+W VFRARLFR+SCV++RGNY+KDLN L
Sbjct: 149 LFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRL 194



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 46/114 (40%), Positives = 54/114 (47%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRS 249
           MDA+SIITQV RDDEQLN Y       P   +++ D   V    P   K+     G   S
Sbjct: 1   MDATSIITQVFRDDEQLNVY-------PSYPNDKDD---VDRLKPQ--KR-----GLFHS 43

Query: 250 LLCCWXXXXXXXXXXXXXTNSIDGRASPPLLVMSEHAPRPLLPPVRHQDMHKKC 411
           LLCCW                IDG  +PP L   +   R LLP VR  DMH+KC
Sbjct: 44  LLCCWRRNRTKTNQNG---TQIDGSTTPPPLPDQQ---RYLLPQVRLTDMHRKC 91


>AE014296-2613|AAF49553.2|  329|Drosophila melanogaster CG5830-PA
           protein.
          Length = 329

 Score =  194 bits (472), Expect = 1e-49
 Identities = 88/106 (83%), Positives = 97/106 (91%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  MVIDLDETLVHSSFKPI NA F+VPVEIDG VHQVYVLKRPHVDEFL++ GELY CV
Sbjct: 89  RKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECV 148

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+W VFRARLFR+SCV++RGNY+KDLN L
Sbjct: 149 LFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRL 194



 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 47/114 (41%), Positives = 55/114 (48%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRS 249
           MDA+SIITQVSRDDEQLN Y       P   +++ D   V    P   K+     G   S
Sbjct: 1   MDATSIITQVSRDDEQLNVY-------PSYPNDKDD---VDRLKPQ--KR-----GLFHS 43

Query: 250 LLCCWXXXXXXXXXXXXXTNSIDGRASPPLLVMSEHAPRPLLPPVRHQDMHKKC 411
           LLCCW                IDG  +PP L   +   R LLP VR  DMH+KC
Sbjct: 44  LLCCWRRNRTKTNQNG---TQIDGSTTPPPLPDQQ---RYLLPQVRLTDMHRKC 91


>AY094776-1|AAM11129.1|  243|Drosophila melanogaster LD04380p
           protein.
          Length = 243

 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 46/115 (40%), Positives = 62/115 (53%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           +  +V+DLDETL+HS        + KP     F V V ID    + +V KRPHVD FL  
Sbjct: 60  RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDV 119

Query: 560 CGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDLNSL 721
             + Y  V+FTAS+  Y   VAD LD    + R R +R  C    G+Y KDL+++
Sbjct: 120 VSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAI 174


>AE014298-3113|AAF50833.1|  243|Drosophila melanogaster CG1696-PA
           protein.
          Length = 243

 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 46/115 (40%), Positives = 62/115 (53%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           +  +V+DLDETL+HS        + KP     F V V ID    + +V KRPHVD FL  
Sbjct: 60  RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDV 119

Query: 560 CGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDLNSL 721
             + Y  V+FTAS+  Y   VAD LD    + R R +R  C    G+Y KDL+++
Sbjct: 120 VSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAI 174


>BT022639-1|AAY55055.1|  253|Drosophila melanogaster IP07723p
           protein.
          Length = 253

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 10/113 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-----KPINN---AH-FVVPVEIDGAVHQVYVLKRPHVDEFLR 556
           +  +V+D+D T++ S F     KP N    AH F   +   GA   +YV KRP++D FL 
Sbjct: 70  RKTLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGAT--IYVYKRPYLDHFLD 127

Query: 557 RCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           R  + Y   +FT+    YA P+ D LDR  G+  +RL+R  C+   G + K +
Sbjct: 128 RVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKSV 180


>AE014296-614|AAF47748.2|  253|Drosophila melanogaster CG12078-PA
           protein.
          Length = 253

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 10/113 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-----KPINN---AH-FVVPVEIDGAVHQVYVLKRPHVDEFLR 556
           +  +V+D+D T++ S F     KP N    AH F   +   GA   +YV KRP++D FL 
Sbjct: 70  RKTLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGAT--IYVYKRPYLDHFLD 127

Query: 557 RCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           R  + Y   +FT+    YA P+ D LDR  G+  +RL+R  C+   G + K +
Sbjct: 128 RVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKSV 180


>AY089227-1|AAL89965.1|  293|Drosophila melanogaster AT02326p
           protein.
          Length = 293

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 16/119 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPINNAH-------------FVVPVEIDGAVHQVY-VLKRPH 538
           +  +V+DLDETLVHS +  P  + +             +V+ + IDG    V+ V KRPH
Sbjct: 95  RKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPH 154

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           VDEFL    + Y  V++TASL  YA  V D LD   G+   R +R  C        KDL
Sbjct: 155 VDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDL 213


>AE013599-696|AAF59057.2|  293|Drosophila melanogaster CG8584-PA
           protein.
          Length = 293

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 16/119 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPINNAH-------------FVVPVEIDGAVHQVY-VLKRPH 538
           +  +V+DLDETLVHS +  P  + +             +V+ + IDG    V+ V KRPH
Sbjct: 95  RKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPH 154

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           VDEFL    + Y  V++TASL  YA  V D LD   G+   R +R  C        KDL
Sbjct: 155 VDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDL 213


>AE014296-72|AAF47370.1|  409|Drosophila melanogaster CG12313-PA
           protein.
          Length = 409

 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 27/65 (41%), Positives = 38/65 (58%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD FL+ C + +  V++TA       P+ D LD  G    RL RDS  F  G++VK
Sbjct: 235 KRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVK 294

Query: 707 DLNSL 721
           +L++L
Sbjct: 295 NLDNL 299


>AY070535-1|AAL48006.1|  428|Drosophila melanogaster LD05179p
           protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 27/65 (41%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD FL  C + +  V+FTA       P+ D LD  G    RL RD+  F  G++VK
Sbjct: 254 KRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVK 313

Query: 707 DLNSL 721
           +L++L
Sbjct: 314 NLDNL 318


>AE014298-458|AAF45820.2|  428|Drosophila melanogaster CG2713-PA
           protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 27/65 (41%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD FL  C + +  V+FTA       P+ D LD  G    RL RD+  F  G++VK
Sbjct: 254 KRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVK 313

Query: 707 DLNSL 721
           +L++L
Sbjct: 314 NLDNL 318


>AY122238-1|AAM52750.1|  896|Drosophila melanogaster SD01014p
           protein.
          Length = 896

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = +2

Query: 386 DTRTCI---KSVMVIDLDETLVHSSFKPI-NNAHFVVPVEIDGAVHQVYVLK-RPHVDEF 550
           DTR  +   K V+++DLD+T++H++   + +N   +   ++ G     Y  + RP   EF
Sbjct: 214 DTRRLLADRKLVLLVDLDQTVIHTTNDTVPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEF 273

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRAR--LFRDSCVFHRGNYVKDLNSL 721
           L R  +LY   + T     YA  +A LLD  G F +   L RD C F+  +   +L +L
Sbjct: 274 LERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKAL 331


>AE013599-3903|AAF47230.1|  880|Drosophila melanogaster CG12252-PA
           protein.
          Length = 880

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = +2

Query: 386 DTRTCI---KSVMVIDLDETLVHSSFKPI-NNAHFVVPVEIDGAVHQVYVLK-RPHVDEF 550
           DTR  +   K V+++DLD+T++H++   + +N   +   ++ G     Y  + RP   EF
Sbjct: 198 DTRRLLADRKLVLLVDLDQTVIHTTNDTVPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEF 257

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRAR--LFRDSCVFHRGNYVKDLNSL 721
           L R  +LY   + T     YA  +A LLD  G F +   L RD C F+  +   +L +L
Sbjct: 258 LERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKAL 315


>AL021728-7|CAA16816.1|  415|Drosophila melanogaster EG:95B7.3
           protein.
          Length = 415

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 24/59 (40%), Positives = 31/59 (52%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           KRP VD FL  C + +  V+FTA       P+ D LD  G    RL RD+  F  G++V
Sbjct: 254 KRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVGGHHV 312


>AY089295-1|AAL90033.1|  172|Drosophila melanogaster AT08867p
           protein.
          Length = 172

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +2

Query: 581 VLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           V++TA       P+ D LD  G    RL RDS  F  G++VK+L++L
Sbjct: 16  VVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNL 62


>AJ130871-1|CAA10224.1| 1464|Drosophila melanogaster Bazooka protein
           protein.
          Length = 1464

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLG 210
           +D    +  V+ D EQ+  +  D G  PGV    GDG   SGS+ +G
Sbjct: 57  LDPDDCVRDVADDREQILAHFDDPGPDPGVPQGGGDG--ASGSSSVG 101


>AF203342-1|AAF13280.1| 1729|Drosophila melanogaster pericardine
           protein.
          Length = 1729

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 770 PSYGSQPGVGAQNGGGQPGYGTRPVIGGQTGAGQPGY 806



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 211 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 247



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 228 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 264



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 245 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 281



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 262 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 298



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 313 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 349



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 483 PGYGSQPGIGAQTGAGQPGYGSQPGIGGQTGAGQPGY 519



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 500 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 536



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 551 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 587



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PGV    G G P  GS P +GG+  +G  G+
Sbjct: 602 PGYGSQPGVGTQIGAGQPGYGSQPGIGGQTGAGQPGY 638



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+  +G  G+
Sbjct: 381 PGYGTQPGIGGQTGPGQPGYGSQPGIGGQTGAGQPGY 417



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  G+ P +GG+  +G  G+
Sbjct: 279 PGYGSQPGIGGQTGAGQPGYGTQPGIGGQTGAGQPGY 315



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+  +G  G+
Sbjct: 296 PGYGTQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 332



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  G+ P +GG+  +G  G+
Sbjct: 330 PGYGSQPGIGGQTGAGQPGYGTQPGIGGQTGAGQPGY 366



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  G+ P +GG+  +G  G+
Sbjct: 398 PGYGSQPGIGGQTGAGQPGYGTQPGIGGQTGAGQPGY 434



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+  +G  G+
Sbjct: 534 PGYGTQPGIGAQTGAGQPGYGSQPGIGGQTGAGQPGY 570



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGFLR 246
           P  G+ PGV    G G P  G+ P +GG+  +G  G+ R
Sbjct: 653 PGYGTQPGVGAQTGTGQPGYGAQPGIGGQTGAGQPGYGR 691



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 704 PGYGTQPGVGTQTGTGQPGYGAQPGIGGQSGAGQPGY 740



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+   G  G+
Sbjct: 721 PGYGAQPGIGGQSGAGQPGYGSQPGIGGQTGGGQPGY 757



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133  PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
            P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 1057 PGYGNQPGVGGQTGAGQPGYGSQPGVGGQTGAGQPGY 1093



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGS-TPLGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS T +GG+  +G  G+
Sbjct: 177 PGYGAQPGVGAQTGAGQPGYGSQTGIGGQTGAGQPGY 213



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  G+ P +GG+  +G  G+
Sbjct: 432 PGYGTQPGIGAQTGAGQPGYGTQPGIGGQTGAGQPGY 468



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +   G+
Sbjct: 619 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAAQPGY 655



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133  PDRGSSPGVQHNEGDGTPVSGS-TPLGGKKSSGTGGF 240
            P  GS PG+    G G P  GS T +GG+  +G  G+
Sbjct: 994  PGYGSQPGIGGQTGAGQPGYGSQTGVGGQIGAGQPGY 1030



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  G+ P +GG+   G  G+
Sbjct: 364 PGYGTQPGIGGQTGPGQPGYGTQPGIGGQTGPGQPGY 400


>AE014298-2531|ABI30988.1| 1520|Drosophila melanogaster CG5055-PB,
           isoform B protein.
          Length = 1520

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLG 210
           +D    +  V+ D EQ+  +  D G  PGV    GDG   SGS+ +G
Sbjct: 78  LDPDDCVRDVADDREQILAHFDDPGPDPGVPQGGGDG--ASGSSSVG 122


>AE014298-2530|AAF48703.1| 1464|Drosophila melanogaster CG5055-PA,
           isoform A protein.
          Length = 1464

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLG 210
           +D    +  V+ D EQ+  +  D G  PGV    GDG   SGS+ +G
Sbjct: 57  LDPDDCVRDVADDREQILAHFDDPGPDPGVPQGGGDG--ASGSSSVG 101


>BT009991-1|AAQ22460.1| 1071|Drosophila melanogaster RE39441p
           protein.
          Length = 1071

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 177 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 213



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 708 PSYGSQPGVGAQNGAGQPGYGTQPVIGGQTGAGQPGY 744



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 330 PGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGY 366



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 381 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 417



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 449 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 485



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 500 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 536



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 551 PGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGY 587



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+  +G  G+
Sbjct: 279 PGYGAQPGILGQTGAGQPGYGSQPGIGGQTGAGQPGY 315



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G  PGV    G G P  GS P +GG+  +G  G+
Sbjct: 160 PGYGDQPGVGTQPGVGQPGYGSQPGIGGQTGAGQPGY 196



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+   G  G+
Sbjct: 659 PGYGTQPGIGGQTGAGQPGYGSQPGIGGQTGGGQPGY 695



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           P  GS PG+    G G P  GS P+ G + +GTG
Sbjct: 194 PGYGSQPGIGGQTGAGQPGYGSQPVVGAQ-TGTG 226



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 625 PGYGTQPGVGAQTGTGQPGYGAQPGVGGQTGAGQPGY 661



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 642 PGYGAQPGVGGQTGAGQPGYGTQPGIGGQTGAGQPGY 678



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +G +  +G  G+
Sbjct: 466 PGYGSQPGIGGQTGAGQPGYGSQPGVGAQTGAGQPGY 502


>AE014296-2068|AAF49980.2| 1713|Drosophila melanogaster CG5700-PB
           protein.
          Length = 1713

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +GG+  +G  G+
Sbjct: 177 PGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGY 213



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 708 PSYGSQPGVGAQNGAGQPGYGTQPVIGGQTGAGQPGY 744



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 330 PGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGY 366



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 381 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 417



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 449 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 485



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 500 PGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGY 536



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 551 PGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGY 587



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133  PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
            P  G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 978  PGYGNQPGVGGQTGAGQPGYGSQPGIGGQTGAGQPGY 1014



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+  +G  G+
Sbjct: 279 PGYGAQPGILGQTGAGQPGYGSQPGIGGQTGAGQPGY 315



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G  PGV    G G P  GS P +GG+  +G  G+
Sbjct: 160 PGYGDQPGVGTQPGVGQPGYGSQPGIGGQTGAGQPGY 196



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PG+    G G P  GS P +GG+   G  G+
Sbjct: 659 PGYGTQPGIGGQTGAGQPGYGSQPGIGGQTGGGQPGY 695



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           P  GS PG+    G G P  GS P+ G + +GTG
Sbjct: 194 PGYGSQPGIGGQTGAGQPGYGSQPVVGAQ-TGTG 226



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 625 PGYGTQPGVGAQTGTGQPGYGAQPGVGGQTGAGQPGY 661



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  G+ PGV    G G P  G+ P +GG+  +G  G+
Sbjct: 642 PGYGAQPGVGGQTGAGQPGYGTQPGIGGQTGAGQPGY 678



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
           P  GS PG+    G G P  GS P +G +  +G  G+
Sbjct: 466 PGYGSQPGIGGQTGAGQPGYGSQPGVGAQTGAGQPGY 502



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = +1

Query: 142  GSSPGVQHNEGDGTPVSGSTP-LGGKKSSGTGGF 240
            G+ PGV    G G P  GS P +GG+  +G  G+
Sbjct: 1027 GNQPGVGGQTGAGQPGYGSQPGVGGQTGAGQPGY 1060


>AY118321-1|AAM48350.1|  111|Drosophila melanogaster LD08201p
           protein.
          Length = 111

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +2

Query: 608 YADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDLNSL 721
           Y   VAD LD    + R R +R  C    G+Y KDL+++
Sbjct: 4   YGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAI 42


>BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p
           protein.
          Length = 575

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +1

Query: 121 NNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           ++YG   GS PG + ++  G P SGS   GG   SG GG
Sbjct: 298 SSYGAP-GSGPGGRPSDSYGPPASGS-GAGGAGGSGPGG 334


>AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-PB,
           isoform B protein.
          Length = 575

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +1

Query: 121 NNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           ++YG   GS PG + ++  G P SGS   GG   SG GG
Sbjct: 298 SSYGAP-GSGPGGRPSDSYGPPASGS-GAGGAGGSGPGG 334


>AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-PA,
           isoform A protein.
          Length = 620

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +1

Query: 121 NNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           ++YG   GS PG + ++  G P SGS   GG   SG GG
Sbjct: 298 SSYGAP-GSGPGGRPSDSYGPPASGS-GAGGAGGSGPGG 334


>AY119139-1|AAM50999.1|  615|Drosophila melanogaster RE41430p
           protein.
          Length = 615

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 19/62 (30%), Positives = 24/62 (38%)
 Frame = +1

Query: 49  RPKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSG 228
           R   N  + A++    V +  +QL   GP  G  PG     G G P       GG   SG
Sbjct: 64  RSHENGEVSAAAAAAVVLQQQQQLQ-VGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSG 122

Query: 229 TG 234
            G
Sbjct: 123 AG 124


>AE014298-1780|AAF48175.2|  615|Drosophila melanogaster CG11138-PC,
           isoform C protein.
          Length = 615

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 19/62 (30%), Positives = 24/62 (38%)
 Frame = +1

Query: 49  RPKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSG 228
           R   N  + A++    V +  +QL   GP  G  PG     G G P       GG   SG
Sbjct: 64  RSHENGEVSAAAAAAVVLQQQQQLQ-VGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSG 122

Query: 229 TG 234
            G
Sbjct: 123 AG 124


>AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB,
            isoform B protein.
          Length = 2309

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 20/66 (30%), Positives = 27/66 (40%)
 Frame = +1

Query: 52   PKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGT 231
            P+      ASS     SR  ++    G   G S G Q N G G  +SG     G    G+
Sbjct: 835  PRLEKSASASSAFDSNSRYLQKGGVSGGGGGVSGGAQANAGQGRSISGGYVQRGASVGGS 894

Query: 232  GGFLRS 249
             G+ R+
Sbjct: 895  SGYGRN 900


>AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA,
            isoform A protein.
          Length = 2309

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 20/66 (30%), Positives = 27/66 (40%)
 Frame = +1

Query: 52   PKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGT 231
            P+      ASS     SR  ++    G   G S G Q N G G  +SG     G    G+
Sbjct: 835  PRLEKSASASSAFDSNSRYLQKGGVSGGGGGVSGGAQANAGQGRSISGGYVQRGASVGGS 894

Query: 232  GGFLRS 249
             G+ R+
Sbjct: 895  SGYGRN 900


>AE014296-988|AAN12103.1|  460|Drosophila melanogaster CG32414-PA
           protein.
          Length = 460

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 94  QVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTP 204
           Q  +  +Q  +Y P+ G   G QH+   G  +S S P
Sbjct: 409 QQQQQQQQYMSYAPEMGGYTGCQHDPQGGYQLSSSAP 445


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,463,481
Number of Sequences: 53049
Number of extensions: 808045
Number of successful extensions: 3253
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 2881
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3236
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).