SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT010023-1|AAQ22492.1|  368|Drosophila melanogaster RE07278p pro...    30   3.3  
AE014297-4228|AAF56784.1|  281|Drosophila melanogaster CG14065-P...    30   3.3  
AE014296-3088|AAN11663.1|  474|Drosophila melanogaster CG32204-P...    30   3.3  
S73530-1|AAB32328.1|  536|Drosophila melanogaster phr protein.         29   5.8  
D26021-1|BAA05042.1|  640|Drosophila melanogaster photolyase pro...    29   5.8  
AY084133-1|AAL89871.1|  555|Drosophila melanogaster RE21178p pro...    29   5.8  
AE013599-515|AAM68868.1|  535|Drosophila melanogaster CG11205-PB...    29   5.8  
AE013599-514|AAF59185.1|  555|Drosophila melanogaster CG11205-PA...    29   5.8  
AE014297-4028|AAN14096.1|  248|Drosophila melanogaster CG6323-PB...    29   7.7  

>BT010023-1|AAQ22492.1|  368|Drosophila melanogaster RE07278p
           protein.
          Length = 368

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 605 GNGKHPRELIKHHNSMLTLSPQRSNSNKLQNNSRRSLLKRLFQK*SVAGPR 757
           G G+  R   K  ++++ +  QRS S +  NN R  L+ +   K  +A P+
Sbjct: 282 GAGRATRSRSKPRSAVVKVKGQRSGSRRTNNNIRSVLINKRHNKYKIARPQ 332


>AE014297-4228|AAF56784.1|  281|Drosophila melanogaster CG14065-PA
           protein.
          Length = 281

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +1

Query: 403 AARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRR 582
           AA   A G  P   SV   + GE  K    +  +    A    ++++   FVPV+SH RR
Sbjct: 74  AAAAEAAGESPIVGSVSLAQTGE--KRAAASGGDNT--AENSSELDDNNDFVPVLSHHRR 129

Query: 583 PGKN-RRDRERKAPP 624
             K  R+++ R   P
Sbjct: 130 DRKKARKEKPRDQQP 144


>AE014296-3088|AAN11663.1|  474|Drosophila melanogaster CG32204-PA
           protein.
          Length = 474

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 605 GNGKHPRELIKHHNSMLTLSPQRSNSNKLQNNSRRSLLKRLFQK*SVAGPR 757
           G G+  R   K  ++++ +  QRS S +  NN R  L+ +   K  +A P+
Sbjct: 294 GAGRATRSRSKPRSAVVKVKGQRSGSRRTNNNIRSVLINKRHNKYKIARPQ 344


>S73530-1|AAB32328.1|  536|Drosophila melanogaster phr protein.
          Length = 536

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +1

Query: 409 RVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAP----PRPDIEEEEGFVPVISHG 576
           R  A+ AGPS  +  N K     K + E+  EEA  +      +PD +  E F+  + H 
Sbjct: 3   RTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQ 62

Query: 577 R 579
           R
Sbjct: 63  R 63


>D26021-1|BAA05042.1|  640|Drosophila melanogaster photolyase
           protein.
          Length = 640

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +1

Query: 409 RVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAP----PRPDIEEEEGFVPVISHG 576
           R  A+ AGPS  +  N K     K + E+  EEA  +      +PD +  E F+  + H 
Sbjct: 108 RTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQ 167

Query: 577 R 579
           R
Sbjct: 168 R 168


>AY084133-1|AAL89871.1|  555|Drosophila melanogaster RE21178p
           protein.
          Length = 555

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +1

Query: 409 RVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAP----PRPDIEEEEGFVPVISHG 576
           R  A+ AGPS  +  N K     K + E+  EEA  +      +PD +  E F+  + H 
Sbjct: 23  RTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQ 82

Query: 577 R 579
           R
Sbjct: 83  R 83


>AE013599-515|AAM68868.1|  535|Drosophila melanogaster CG11205-PB,
           isoform B protein.
          Length = 535

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +1

Query: 409 RVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAP----PRPDIEEEEGFVPVISHG 576
           R  A+ AGPS  +  N K     K + E+  EEA  +      +PD +  E F+  + H 
Sbjct: 3   RTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQ 62

Query: 577 R 579
           R
Sbjct: 63  R 63


>AE013599-514|AAF59185.1|  555|Drosophila melanogaster CG11205-PA,
           isoform A protein.
          Length = 555

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +1

Query: 409 RVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAP----PRPDIEEEEGFVPVISHG 576
           R  A+ AGPS  +  N K     K + E+  EEA  +      +PD +  E F+  + H 
Sbjct: 23  RTKAQKAGPSKKAAKNEKASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFLTHLEHQ 82

Query: 577 R 579
           R
Sbjct: 83  R 83


>AE014297-4028|AAN14096.1|  248|Drosophila melanogaster CG6323-PB,
           isoform B protein.
          Length = 248

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -2

Query: 504 LCVGLNVFFITFASFEVEHGRVRGSC 427
           LC GL +FF +F  F +   R+RG+C
Sbjct: 185 LCGGLGIFF-SFTEFAIAIKRIRGAC 209


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,893,633
Number of Sequences: 53049
Number of extensions: 823150
Number of successful extensions: 3884
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3310
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3858
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3880595628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).