SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY050231-1|AAK84930.1|  559|Drosophila melanogaster SD01637p pro...    57   4e-08
AE013599-2399|AAS64825.1|  559|Drosophila melanogaster CG8963-PB...    57   4e-08
AE013599-2398|AAF57917.1|  559|Drosophila melanogaster CG8963-PA...    57   4e-08
AY113372-1|AAM29377.1|  526|Drosophila melanogaster LP02990p pro...    39   0.011
AE014134-48|AAF51541.1|  953|Drosophila melanogaster CG4648-PA p...    39   0.011
BT029946-1|ABM92820.1|  637|Drosophila melanogaster IP16971p pro...    35   0.14 
AE013599-669|AAF59074.1|  417|Drosophila melanogaster CG14747-PA...    35   0.14 
AY122157-1|AAM52669.1|  780|Drosophila melanogaster LD10695p pro...    33   0.57 
AE014135-124|AAF59321.1|  767|Drosophila melanogaster CG1783-PA ...    33   0.57 
AY274408-1|AAP31562.1|  238|Drosophila melanogaster heat shock f...    33   0.75 
M60070-1|AAA28642.1|  691|Drosophila melanogaster heat shock tra...    31   1.7  
AY274412-1|AAP31566.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY274411-1|AAP31565.1|  239|Drosophila melanogaster heat shock f...    31   1.7  
AY274409-1|AAP31563.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY274407-1|AAP31561.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY274406-1|AAP31560.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY274405-1|AAP31559.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY274404-1|AAP31558.1|  238|Drosophila melanogaster heat shock f...    31   1.7  
AY070650-1|AAL48121.1|  214|Drosophila melanogaster RH03540p pro...    31   1.7  
AY058761-1|AAL13990.1|  662|Drosophila melanogaster SD02833p pro...    31   1.7  
AE014298-1179|AAF46374.2|  214|Drosophila melanogaster CG15347-P...    31   1.7  
AE013599-2619|ABI31102.1|  733|Drosophila melanogaster CG5748-PD...    31   1.7  
AE013599-2618|ABI31104.1|  715|Drosophila melanogaster CG5748-PB...    31   1.7  
AE013599-2617|ABI31103.1|  709|Drosophila melanogaster CG5748-PC...    31   1.7  
AE013599-2616|AAF57749.1|  691|Drosophila melanogaster CG5748-PA...    31   1.7  
AB211170-1|BAE16323.1|  733|Drosophila melanogaster heat shock t...    31   1.7  
AB211169-1|BAE16322.1|  709|Drosophila melanogaster heat shock t...    31   1.7  
AB211168-1|BAE16321.1|  715|Drosophila melanogaster heat shock t...    31   1.7  
AY075223-1|AAL68090.1|  237|Drosophila melanogaster AT17586p pro...    31   2.3  
BT014666-1|AAT27290.1| 1360|Drosophila melanogaster GH07037p pro...    30   4.0  
AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p pro...    30   4.0  
AE014297-2654|AAF55660.2|  237|Drosophila melanogaster CG31245-P...    30   4.0  
AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB...    30   4.0  
AE014296-1366|ABI31243.1| 1360|Drosophila melanogaster CG7915-PC...    30   4.0  
AY274410-1|AAP31564.1|  238|Drosophila melanogaster heat shock f...    30   5.3  
BT023496-1|AAY84896.1| 2042|Drosophila melanogaster LP04448p pro...    29   9.2  
AJ249115-1|CAB55772.1| 2050|Drosophila melanogaster microtubule ...    29   9.2  
AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P...    29   9.2  
AE014297-2141|AAF55269.2| 2049|Drosophila melanogaster CG5000-PA...    29   9.2  
AE014296-656|AAN11565.1|  717|Drosophila melanogaster CG12010-PB...    29   9.2  
AE014296-655|AAF47769.1|  736|Drosophila melanogaster CG12010-PA...    29   9.2  

>AY050231-1|AAK84930.1|  559|Drosophila melanogaster SD01637p
           protein.
          Length = 559

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 5/181 (2%)
 Frame = +1

Query: 370 YNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLREN----IANLITVM 537
           +N    P+       Q +  Q Q+Q P      + +   + N    +     +  L TV+
Sbjct: 218 HNQPQQPHHQQHNQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQPDMATIALEYLDTVI 277

Query: 538 CEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYD 717
             +  +PG+FD++    +  F    N++      ++ I  +SI + NFRY GA+L ++  
Sbjct: 278 HCLNQNPGQFDSIASRFLTIFDGMENNQFVLSIAMEDIFEKSIEQPNFRYMGAKLYNLLH 337

Query: 718 SVAQPEESVFRECLLERCSVEENKIISGLETSE-ENMRGFAMFLAEIILSFEDSQGGRIR 894
            +    +S+F   L  +    + ++   + ++E + +R  A+FLAE+ +        RI+
Sbjct: 338 MLNSKPDSLFHTLLKCKLDYHQEEVTKYMRSNEQQKVRETALFLAELYMQLRGDDDSRIQ 397

Query: 895 L 897
           L
Sbjct: 398 L 398


>AE013599-2399|AAS64825.1|  559|Drosophila melanogaster CG8963-PB,
           isoform B protein.
          Length = 559

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 5/181 (2%)
 Frame = +1

Query: 370 YNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLREN----IANLITVM 537
           +N    P+       Q +  Q Q+Q P      + +   + N    +     +  L TV+
Sbjct: 218 HNQPQQPHHQQHNQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQPDMATIALEYLDTVI 277

Query: 538 CEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYD 717
             +  +PG+FD++    +  F    N++      ++ I  +SI + NFRY GA+L ++  
Sbjct: 278 HCLNQNPGQFDSIASRFLTIFDGMENNQFVLSIAMEDIFEKSIEQPNFRYMGAKLYNLLH 337

Query: 718 SVAQPEESVFRECLLERCSVEENKIISGLETSE-ENMRGFAMFLAEIILSFEDSQGGRIR 894
            +    +S+F   L  +    + ++   + ++E + +R  A+FLAE+ +        RI+
Sbjct: 338 MLNSKPDSLFHTLLKCKLDYHQEEVTKYMRSNEQQKVRETALFLAELYMQLRGDDDSRIQ 397

Query: 895 L 897
           L
Sbjct: 398 L 398


>AE013599-2398|AAF57917.1|  559|Drosophila melanogaster CG8963-PA,
           isoform A protein.
          Length = 559

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 5/181 (2%)
 Frame = +1

Query: 370 YNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLREN----IANLITVM 537
           +N    P+       Q +  Q Q+Q P      + +   + N    +     +  L TV+
Sbjct: 218 HNQPQQPHHQQHNQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQPDMATIALEYLDTVI 277

Query: 538 CEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYD 717
             +  +PG+FD++    +  F    N++      ++ I  +SI + NFRY GA+L ++  
Sbjct: 278 HCLNQNPGQFDSIASRFLTIFDGMENNQFVLSIAMEDIFEKSIEQPNFRYMGAKLYNLLH 337

Query: 718 SVAQPEESVFRECLLERCSVEENKIISGLETSE-ENMRGFAMFLAEIILSFEDSQGGRIR 894
            +    +S+F   L  +    + ++   + ++E + +R  A+FLAE+ +        RI+
Sbjct: 338 MLNSKPDSLFHTLLKCKLDYHQEEVTKYMRSNEQQKVRETALFLAELYMQLRGDDDSRIQ 397

Query: 895 L 897
           L
Sbjct: 398 L 398


>AY113372-1|AAM29377.1|  526|Drosophila melanogaster LP02990p
           protein.
          Length = 526

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +2

Query: 644 MPLLISQSAKQISGTMELVCVQCTIQWRNLRSLYSASACSSAVPLRKTRLSAAWKLQRRI 823
           M  LI   A+ +   M + C+Q T   RNLRS  + ++C +A  L   + ++   LQ+  
Sbjct: 328 MVRLIRYHAETLDNQMHMTCIQLTRSVRNLRSQVARASCQAAAELFSLKSTS---LQQE- 383

Query: 824 CVDLLCSL 847
           C DL+C+L
Sbjct: 384 CDDLVCAL 391


>AE014134-48|AAF51541.1|  953|Drosophila melanogaster CG4648-PA
           protein.
          Length = 953

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +2

Query: 644 MPLLISQSAKQISGTMELVCVQCTIQWRNLRSLYSASACSSAVPLRKTRLSAAWKLQRRI 823
           M  LI   A+ +   M + C+Q T   RNLRS  + ++C +A  L   + ++   LQ+  
Sbjct: 755 MVRLIRYHAETLDNQMHMTCIQLTRSVRNLRSQVARASCQAAAELFSLKSTS---LQQE- 810

Query: 824 CVDLLCSL 847
           C DL+C+L
Sbjct: 811 CDDLVCAL 818


>BT029946-1|ABM92820.1|  637|Drosophila melanogaster IP16971p
           protein.
          Length = 637

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%)
 Frame = +1

Query: 205 PKGR-GRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTE 381
           P GR   G      +   R P+  +D P+      + +AD  E+ P  Y     P+Y   
Sbjct: 293 PTGRPSSGSSEERPSYAARPPRPTADRPEYPPGPPRPTADRPEYPPRPYEGSTPPSYGPR 352

Query: 382 PAP-YRPSR 405
           P+P Y P R
Sbjct: 353 PSPSYDPDR 361


>AE013599-669|AAF59074.1|  417|Drosophila melanogaster CG14747-PA
           protein.
          Length = 417

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%)
 Frame = +1

Query: 205 PKGR-GRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTE 381
           P GR   G      +   R P+  +D P+      + +AD  E+ P  Y     P+Y   
Sbjct: 240 PTGRPSSGSSEERPSYAARPPRPTADRPEYPPGPPRPTADRPEYPPRPYEGSTPPSYGPR 299

Query: 382 PAP-YRPSR 405
           P+P Y P R
Sbjct: 300 PSPSYDPDR 308


>AY122157-1|AAM52669.1|  780|Drosophila melanogaster LD10695p
           protein.
          Length = 780

 Score = 33.1 bits (72), Expect = 0.57
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 715 DSVAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAEIILSFEDSQGGRI 891
           D+  + E  +F +CL     +EE  ++ G+E S  N  G  +  + I  S  D+  G I
Sbjct: 168 DNFIEHEHHLFEQCLEPEIDIEEVTLVKGVEQSSSNQIGLIVTSSGIQQSSTDTNKGDI 226


>AE014135-124|AAF59321.1|  767|Drosophila melanogaster CG1783-PA
           protein.
          Length = 767

 Score = 33.1 bits (72), Expect = 0.57
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 715 DSVAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAEIILSFEDSQGGRI 891
           D+  + E  +F +CL     +EE  ++ G+E S  N  G  +  + I  S  D+  G I
Sbjct: 155 DNFIEHEHHLFEQCLEPEIDIEEVTLVKGVEQSSSNQIGLIVTSSGIQQSSTDTNKGDI 213


>AY274408-1|AAP31562.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 32.7 bits (71), Expect = 0.75
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D SAPK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSAPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>M60070-1|AAA28642.1|  691|Drosophila melanogaster heat shock
           transcription factor protein.
          Length = 691

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AY274412-1|AAP31566.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274411-1|AAP31565.1|  239|Drosophila melanogaster heat shock
           factor protein.
          Length = 239

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274409-1|AAP31563.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274407-1|AAP31561.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274406-1|AAP31560.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQWTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274405-1|AAP31559.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY274404-1|AAP31558.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 58


>AY070650-1|AAL48121.1|  214|Drosophila melanogaster RH03540p
           protein.
          Length = 214

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = -2

Query: 746 NTDSSGCATESYIEHKRAPLYR 681
           N+ SS CATE+Y+  K  PLY+
Sbjct: 110 NSTSSSCATETYVSAKICPLYK 131


>AY058761-1|AAL13990.1|  662|Drosophila melanogaster SD02833p
           protein.
          Length = 662

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AE014298-1179|AAF46374.2|  214|Drosophila melanogaster CG15347-PA
           protein.
          Length = 214

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = -2

Query: 746 NTDSSGCATESYIEHKRAPLYR 681
           N+ SS CATE+Y+  K  PLY+
Sbjct: 110 NSTSSSCATETYVSAKICPLYK 131


>AE013599-2619|ABI31102.1|  733|Drosophila melanogaster CG5748-PD,
           isoform D protein.
          Length = 733

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AE013599-2618|ABI31104.1|  715|Drosophila melanogaster CG5748-PB,
           isoform B protein.
          Length = 715

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AE013599-2617|ABI31103.1|  709|Drosophila melanogaster CG5748-PC,
           isoform C protein.
          Length = 709

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AE013599-2616|AAF57749.1|  691|Drosophila melanogaster CG5748-PA,
           isoform A protein.
          Length = 691

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AB211170-1|BAE16323.1|  733|Drosophila melanogaster heat shock
           transcription factor d protein.
          Length = 733

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AB211169-1|BAE16322.1|  709|Drosophila melanogaster heat shock
           transcription factor c protein.
          Length = 709

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AB211168-1|BAE16321.1|  715|Drosophila melanogaster heat shock
           transcription factor b protein.
          Length = 715

 Score = 31.5 bits (68), Expect = 1.7
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S+ +P
Sbjct: 427 DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISEDMP 484


>AY075223-1|AAL68090.1|  237|Drosophila melanogaster AT17586p
           protein.
          Length = 237

 Score = 31.1 bits (67), Expect = 2.3
 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 1/62 (1%)
 Frame = +1

Query: 295 TSKSKLSADAKEWYPANYTSQA-LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMS 471
           T+  KL     EW   N   ++ +P     P P R  +P    R   A     Y +D M+
Sbjct: 2   TATQKLRTSTMEWCDRNSRPKSSIPTPAVRPEPTRWQKPGPMSRNEWANFHKTYQVDTMA 61

Query: 472 YS 477
           Y+
Sbjct: 62  YN 63


>BT014666-1|AAT27290.1| 1360|Drosophila melanogaster GH07037p
           protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 4.0
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +1

Query: 169 LIVKMNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSK 303
           L++K+N  ++ A  G G G  +    REL+  K ++D    DT+K
Sbjct: 720 LLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAK 764


>AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p
           protein.
          Length = 1052

 Score = 30.3 bits (65), Expect = 4.0
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +1

Query: 169 LIVKMNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSK 303
           L++K+N  ++ A  G G G  +    REL+  K ++D    DT+K
Sbjct: 694 LLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAK 738


>AE014297-2654|AAF55660.2|  237|Drosophila melanogaster CG31245-PA
           protein.
          Length = 237

 Score = 30.3 bits (65), Expect = 4.0
 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 1/62 (1%)
 Frame = +1

Query: 295 TSKSKLSADAKEWYPANYTSQA-LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMS 471
           T+  KL     EW   N   ++ +P     P P R  +P    R   A     Y +D M+
Sbjct: 2   TATQKLRTSTMEWCDRNSRPKSSIPNPAVRPEPTRWQKPGPMSRNEWANFHKTYQVDTMA 61

Query: 472 YS 477
           Y+
Sbjct: 62  YN 63


>AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB,
           isoform B protein.
          Length = 1052

 Score = 30.3 bits (65), Expect = 4.0
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +1

Query: 169 LIVKMNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSK 303
           L++K+N  ++ A  G G G  +    REL+  K ++D    DT+K
Sbjct: 694 LLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAK 738


>AE014296-1366|ABI31243.1| 1360|Drosophila melanogaster CG7915-PC,
           isoform C protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 4.0
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +1

Query: 169 LIVKMNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSK 303
           L++K+N  ++ A  G G G  +    REL+  K ++D    DT+K
Sbjct: 720 LLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAK 764


>AY274410-1|AAP31564.1|  238|Drosophila melanogaster heat shock
           factor protein.
          Length = 238

 Score = 29.9 bits (64), Expect = 5.3
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +1

Query: 193 DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           D S+PK +    Q + Q   + +P  +  EP+  +    L   A + Y  N+ S  +P
Sbjct: 1   DSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFISGDMP 58


>BT023496-1|AAY84896.1| 2042|Drosophila melanogaster LP04448p
           protein.
          Length = 2042

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQ-DQNPYNLDDMSYSLEEAENMDLRENI 516
           L     EP+ Y  S+   Q ++  A   ++ YN DD    +EE + MDL + +
Sbjct: 221 LKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVEEIDPMDLLDPV 273


>AJ249115-1|CAB55772.1| 2050|Drosophila melanogaster microtubule
           associated protein protein.
          Length = 2050

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQ-DQNPYNLDDMSYSLEEAENMDLRENI 516
           L     EP+ Y  S+   Q ++  A   ++ YN DD    +EE + MDL + +
Sbjct: 221 LKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVEEIDPMDLLDPV 273


>AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-PA
           protein.
          Length = 1895

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 34/142 (23%), Positives = 53/142 (37%), Gaps = 9/142 (6%)
 Frame = +1

Query: 238 NQAREL-RRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPA--YNTEPAPYRPSRP 408
           NQA  L ++P +  D P     K K+SADA  +YP       + +    T P+  R S P
Sbjct: 255 NQAHSLLQKPSSKQDRP----IKVKMSADAPVFYPMGTRLSTILSNEEETPPSSARNSAP 310

Query: 409 SVQGRLRQAQDQNPY------NLDDMSYSLEEAENMDLRENIANLITVMCEITFDPGKFD 570
                   A    PY      ++    Y ++      +  N     T +  I   P + D
Sbjct: 311 RNSFEFGLANGTGPYIGPGGGDIPRSYYFVDPTTGKRINNNNTGTKTEVHRIELIPNRRD 370

Query: 571 TLCGPLVDSFASTLNDESYTRP 636
                  +S+ + LN +  T P
Sbjct: 371 IPQSKARESWIANLNKKPTTPP 392


>AE014297-2141|AAF55269.2| 2049|Drosophila melanogaster CG5000-PA
           protein.
          Length = 2049

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQ-DQNPYNLDDMSYSLEEAENMDLRENI 516
           L     EP+ Y  S+   Q ++  A   ++ YN DD    +EE + MDL + +
Sbjct: 221 LKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVEEIDPMDLLDPV 273


>AE014296-656|AAN11565.1|  717|Drosophila melanogaster CG12010-PB,
           isoform B protein.
          Length = 717

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%)
 Frame = +1

Query: 556 PGKFDTLC---GPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYDSVA 726
           PG+FD L     P   S  + L   S   P  + +  Q I     RY+GA LC++ +  A
Sbjct: 613 PGRFDKLIHVPAPDEKSRLALLKLHSQRMPFHENVFLQEIAARTDRYSGADLCNLCNEAA 672


>AE014296-655|AAF47769.1|  736|Drosophila melanogaster CG12010-PA,
           isoform A protein.
          Length = 736

 Score = 29.1 bits (62), Expect = 9.2
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%)
 Frame = +1

Query: 556 PGKFDTLC---GPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYDSVA 726
           PG+FD L     P   S  + L   S   P  + +  Q I     RY+GA LC++ +  A
Sbjct: 632 PGRFDKLIHVPAPDEKSRLALLKLHSQRMPFHENVFLQEIAARTDRYSGADLCNLCNEAA 691


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 44,245,755
Number of Sequences: 53049
Number of extensions: 1021905
Number of successful extensions: 2891
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 2659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2880
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4648779081
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).