SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p pro...    71   9e-13
AY180919-1|AAN87272.1|  884|Drosophila melanogaster ORF1 protein.      67   2e-11
AF456125-1|AAL57609.1|  832|Drosophila melanogaster reverse tran...    67   2e-11
AM040242-2|CAJ13338.1| 1103|Drosophila melanogaster pol protein ...    62   5e-10
AJ542582-2|CAD65871.1| 1103|Drosophila melanogaster pol protein ...    62   5e-10
AJ542581-2|CAD65869.1| 1103|Drosophila melanogaster pol protein ...    62   5e-10
X17551-2|CAA35587.1|  888|Drosophila melanogaster protein ( D.me...    61   1e-09
AY047531-1|AAK77263.1|  888|Drosophila melanogaster GH03753p pro...    60   3e-09
M17214-2|AAA28508.1|  858|Drosophila melanogaster protein ( D.me...    59   4e-09
AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown prot...    57   2e-08
M22874-2|AAA28675.1|  916|Drosophila melanogaster protein ( D.me...    55   6e-08
AY035777-2|AAK77971.1| 1080|Drosophila melanogaster pol protein ...    55   8e-08
U02279-1|AAA18301.1|  964|Drosophila melanogaster protein ( Dros...    54   2e-07
AY561850-2|AAS68534.1| 1080|Drosophila melanogaster pol protein ...    54   2e-07
AM040245-1|CAJ13341.1| 1042|Drosophila melanogaster pol protein ...    54   2e-07
AJ566116-2|CAD92793.1| 1080|Drosophila melanogaster pol protein ...    54   2e-07
U14101-2|AAC46494.1| 1084|Drosophila melanogaster putative rever...    51   1e-06
AY600955-2|AAT12845.1| 1092|Drosophila melanogaster pol protein ...    47   2e-05
AJ302712-2|CAC16871.1| 1227|Drosophila melanogaster pol protein.       40   0.003
M38643-2|AAA28940.1|  192|Drosophila melanogaster protein ( D.me...    38   0.008
M14954-2|AAA70222.2| 1219|Drosophila melanogaster putative ORF2 ...    38   0.008
AJ278684-2|CAB99192.1|  989|Drosophila melanogaster endonuclease...    34   0.16 
AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p pro...    29   0.85 
AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA...    29   0.85 
AY122174-1|AAM52686.1|  877|Drosophila melanogaster LD34142p pro...    31   1.1  
AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA...    31   1.1  
AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB...    31   1.1  
M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle...    30   2.0  
M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenle...    30   2.0  
BT015294-1|AAT94523.1| 1596|Drosophila melanogaster GH01796p pro...    30   2.0  
AY118400-1|AAM48429.1|  608|Drosophila melanogaster RE60058p pro...    30   2.0  
AL031863-1|CAA21315.1|  526|Drosophila melanogaster EG:EG0003.1 ...    30   2.0  
AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA...    30   2.0  
AE013599-2369|AAF57936.2|  608|Drosophila melanogaster CG8910-PA...    30   2.0  
AY058772-1|AAL14001.1|  385|Drosophila melanogaster SD05480p pro...    28   8.1  
AY051912-1|AAK93336.1|  801|Drosophila melanogaster LD39933p pro...    28   8.1  
AE014134-2350|AAF53302.2|  800|Drosophila melanogaster CG7110-PB...    28   8.1  

>AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p
           protein.
          Length = 906

 Score = 71.3 bits (167), Expect = 9e-13
 Identities = 55/173 (31%), Positives = 79/173 (45%), Gaps = 4/173 (2%)
 Frame = +2

Query: 38  HPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTH 217
           H  DI R   C  R  L+ GD NA+H  WG   NS  GR L E        ++    PT 
Sbjct: 121 HFTDIIRA--CGQR-YLVGGDWNARHWLWGDTCNSPRGRELAEALSVTGAKILATGSPTR 177

Query: 218 IPTAAQLQPDVLDVCVHKGLRCPL-TIEALYDLGTPHLPILVTLGMGLTRVATSP--LRP 388
            P      P  +D  V+ G+   L TI   +DL + HLP+++++    T V  SP  +  
Sbjct: 178 YPYVPSHTPSCIDFAVYHGIPDHLATITQSWDLDSDHLPLIISIETDSTHVNPSPRLVTK 237

Query: 389 KVDWELFKRRLVDLPAIQDP-NTPEGVDDAAVRLVDSIRGAIDQATTLVPSGG 544
             D   F R+L  L ++    N+ E ++ A   L +SI  A   +T+ VP  G
Sbjct: 238 HTDLLAFSRQLESLISLNTTLNSGEEIEMAVDNLTESIHRAAAVSTSPVPRIG 290


>AY180919-1|AAN87272.1|  884|Drosophila melanogaster ORF1 protein.
          Length = 884

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCV 265
           L+ GD N++H AW     +  G+ L E +D G +S++ P +PT+IP   + +   LD+C+
Sbjct: 157 LICGDFNSRHRAWKCTRANGWGKILNELSDLGKFSILYPTQPTYIPHNHKAKASTLDLCL 216

Query: 266 HKGLRCPLTIEALYDLGTPHLPILVTLGMGLTR-VATSPLRPKVDWELFKR 415
                       + +L + HLP+++       R V T P+  + +W LFKR
Sbjct: 217 TNIPNQLANPAVMQELSSDHLPVVIKYSTNFMRNVKTYPILGRANWALFKR 267


>AF456125-1|AAL57609.1|  832|Drosophila melanogaster reverse
           transcriptase protein.
          Length = 832

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCV 265
           L+ GD N++H AW     +  G+ L E +D G +S++ P +PT+IP   + +   LD+C+
Sbjct: 105 LICGDFNSRHRAWKCTRANGWGKILNELSDLGKFSILYPTQPTYIPHNHKAKASTLDLCL 164

Query: 266 HKGLRCPLTIEALYDLGTPHLPILVTLGMGLTR-VATSPLRPKVDWELFKR 415
                       + +L + HLP+++       R V T P+  + +W LFKR
Sbjct: 165 TNIPNQLANPAVMQELSSDHLPVVIKYSTNFMRNVKTYPILGRANWALFKR 215


>AM040242-2|CAJ13338.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLED-ADRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           +L GD N KH  WG+ L+ A GR L +    R D  +V     TH P   + QP  LD  
Sbjct: 153 ILGGDWNCKHRLWGNYLSCARGRSLSQSILARKDLDIVATGHATHFPFDKKKQPSALDFA 212

Query: 263 VHKGLRC-PLTIEALYDLGTPHLPILVTL-----GMGLTRVATSPLRPKVDWELFKRRLV 424
           + KG     L   +  +L + HLPI + L          +   + ++ + D   FK+ L 
Sbjct: 213 ICKGFHTQKLKTYSTDELSSDHLPIQIVLDPDDSDWQHNKTNNAIIQKRTDLTKFKKNLE 272

Query: 425 DLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQAT 523
           +   +  +  T + +DD    L+++I+ A ++AT
Sbjct: 273 NKILLNTEIRTGQDIDDCIDILINNIKSAANEAT 306


>AJ542582-2|CAD65871.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLED-ADRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           +L GD N KH  WG+ L+ A GR L +    R D  +V     TH P   + QP  LD  
Sbjct: 153 ILGGDWNCKHRLWGNYLSCARGRSLSQSILARKDLDIVATGHATHFPFDKKKQPSALDFA 212

Query: 263 VHKGLRC-PLTIEALYDLGTPHLPILVTL-----GMGLTRVATSPLRPKVDWELFKRRLV 424
           + KG     L   +  +L + HLPI + L          +   + ++ + D   FK+ L 
Sbjct: 213 ICKGFHTQKLKTYSTDELSSDHLPIQIVLDPDDSDWQHNKTNNAIIQKRTDLTKFKKNLE 272

Query: 425 DLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQAT 523
           +   +  +  T + +DD    L+++I+ A ++AT
Sbjct: 273 NKILLNTEIRTGQDIDDCIDILINNIKSAANEAT 306


>AJ542581-2|CAD65869.1| 1103|Drosophila melanogaster pol protein
           protein.
          Length = 1103

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLED-ADRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           +L GD N KH  WG+ L+ A GR L +    R D  +V     TH P   + QP  LD  
Sbjct: 153 ILGGDWNCKHRLWGNYLSCARGRSLSQSILARKDLDIVATGHATHFPFDKKKQPSALDFA 212

Query: 263 VHKGLRC-PLTIEALYDLGTPHLPILVTL-----GMGLTRVATSPLRPKVDWELFKRRLV 424
           + KG     L   +  +L + HLPI + L          +   + ++ + D   FK+ L 
Sbjct: 213 ICKGFHTQKLKTYSTDELSSDHLPIQIVLDPDDSDWQHNKTNNAIIQKRTDLTKFKKNLE 272

Query: 425 DLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQAT 523
           +   +  +  T + +DD    L+++I+ A ++AT
Sbjct: 273 NKILLNTEIRTGQDIDDCIDILINNIKSAANEAT 306


>X17551-2|CAA35587.1|  888|Drosophila melanogaster protein (
           D.melanogaster white-one mutant DNA with Doc retroposon,
           inserted inwhite locuspromoter region.  ).
          Length = 888

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 7/164 (4%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSV--VGPDEPTHIPTAAQLQPDVLDV 259
           +  GD NAKH  WGSRL S  G++L     + +  +  V P +PT+ P   +  PD++D 
Sbjct: 132 IAAGDYNAKHTHWGSRLVSPKGKQLYNALTKPENKLDYVSPGKPTYWPADPRKIPDLIDF 191

Query: 260 CVHKGL-RCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPLRP---KVDWELFKRRLVD 427
            + K + R  +T EAL DL + H P+ + + +    +   P R    + +W  +++ +  
Sbjct: 192 AITKHVPRNMVTAEALADLSSDHSPVFLNM-LTRPHIVDPPYRLTNFRTNWPRYQKYVCS 250

Query: 428 -LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLVPSGGPRGI 556
            +      +T E +D +   L + +  A   +T  V    P  I
Sbjct: 251 HIELTTALSTKEDIDKSTETLENILVSAAKASTPPVTYAKPNYI 294


>AY047531-1|AAK77263.1|  888|Drosophila melanogaster GH03753p
           protein.
          Length = 888

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 9/166 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSV--VGPDEPTHIPTAAQLQPDVLDV 259
           +  GD NAKH  WGSRL +  G++L     + +  +  V P +PT+ P   +  PD++D 
Sbjct: 132 IAAGDYNAKHTHWGSRLVTPKGKQLYNALTKPENKLDYVSPGKPTYWPADPRKIPDLIDF 191

Query: 260 CVHKGL-RCPLTIEALYDLGTPHLPILVTLGMGLTR--VATSPLRP---KVDWELFKRRL 421
            + K + R  +T EAL DL + H P+ + +   LTR  +   P R    + +W  +++ +
Sbjct: 192 AITKHVPRNMVTAEALADLSSDHSPVFLNM---LTRHHIVDPPYRLTNFRTNWPRYQKYV 248

Query: 422 VD-LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLVPSGGPRGI 556
              +      +T E +D +   L + +  A   +T  V    P  I
Sbjct: 249 CSHIELTTALSTKEDIDKSTETLENILVSAAKASTPPVTYAKPNYI 294


>M17214-2|AAA28508.1|  858|Drosophila melanogaster protein (
           D.melanogaster Fw repetitiveelement putative reverse
           transcriptase, complete cds,and putative binding
           protein, 3' end. ).
          Length = 858

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 5/115 (4%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSV--VGPDEPTHIPTAAQLQPDVLDV 259
           +  GD NAKH  WGSRL +  G++L +   +    +  V P  PT+ P+     PD++D 
Sbjct: 133 IAAGDYNAKHTHWGSRLVNPKGKQLYKTIIKATNKLDHVSPGSPTYWPSDLNKLPDLIDF 192

Query: 260 CVHKGL-RCPLTIEALYDLGTPHLPILVTLGMGLTRV--ATSPLRPKVDWELFKR 415
            V K + R  +  E L DL + H P+L+ L      V   T     K +W  +K+
Sbjct: 193 AVTKNISRSLVKAECLPDLSSDHSPVLIHLRRYAENVKPPTRLTSSKTNWLRYKK 247


>AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown
           protein.
          Length = 908

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 4/172 (2%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   +   + + +L       ++ GD NA H  WG+  ++  G  L       +   + 
Sbjct: 111 PPRFAWTTDEFKDILEEFQTKFIVAGDWNASHWLWGAGRSNQRGIALANLVLNSEVDSLA 170

Query: 200 PDEPTHIPTAAQLQPDVLDVCVHKG-LRCPLTIEALYDLGTPHLPILVTLGMGLTRVATS 376
              PT  P   +  P  +D  + KG L     I A+ +L + HLP+++TL  G       
Sbjct: 171 TGGPTRYPYGCRGSPGYIDFALTKGVLGIHANISAVVELSSDHLPLVITLDAGAISYPKM 230

Query: 377 P--LRPKVDWELFKRRLVD-LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQAT 523
              +  + + E+F+ +L   LP     N+ + VDDA   L ++I+ A   AT
Sbjct: 231 ERLITRRTNLEVFQSQLESTLPLNTAINSGQDVDDAIELLTNNIKSAARLAT 282


>M22874-2|AAA28675.1|  916|Drosophila melanogaster protein (
           D.melanogaster LINEelement J-1, clone J-1. ).
          Length = 916

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 34/110 (30%), Positives = 47/110 (42%), Gaps = 1/110 (0%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   +   D + +        +  GD NAKH  WG+  +   G+ L E    G Y V+ 
Sbjct: 112 PPAERWIVDDFKSMFAALGNKFIAGGDYNAKHAWWGNPRSCPRGKMLQEVIAHGQYQVLA 171

Query: 200 PDEPTHIPTAAQLQPDVLDVCVHKGLRC-PLTIEALYDLGTPHLPILVTL 346
             EPT       L P  LD  +  G     L ++ L +L + HLPIL  L
Sbjct: 172 TGEPTFYSYNPLLTPSALDFFITCGYGMGRLDVQTLQELSSDHLPILAVL 221


>AY035777-2|AAK77971.1| 1080|Drosophila melanogaster pol protein
           protein.
          Length = 1080

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 14/182 (7%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG       G  L E     
Sbjct: 121 PPSLSWSPHHFTDVLNFAEKTLGGQTKFILCGDWNAKHRQWGCTRACQRGTALYEAVQAD 180

Query: 182 DYS-VVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILVTLGMG 355
             + ++     TH P   +  P  +D  + KGL R    I ++ DL + HLPIL+ + + 
Sbjct: 181 PMAEIIATGCATHFPHDTRKNPSAIDFSICKGLGRLEKRISSVADLSSDHLPILLEINLD 240

Query: 356 -----LTRVATSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQ 517
                L +   + L+   + ELFK  L     +  +    E ++DA    + +I+ + D+
Sbjct: 241 TSTLFLQKQNNNILKKTTNIELFKTVLERKILLNTEIRVAEDINDAINIFIKNIKDSADE 300

Query: 518 AT 523
           +T
Sbjct: 301 ST 302


>U02279-1|AAA18301.1|  964|Drosophila melanogaster protein (
           Drosophila melanogastertelomere-associated transposons
           TART, TART-A and HeT-A,and TART-A ORF2 gene, partial
           cds. ).
          Length = 964

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 14/182 (7%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG       G  L E     
Sbjct: 5   PPSLSWSPHHFTDVLNFAEKTLGGQTKFILCGDWNAKHRQWGCTRACQRGTALYEAVQAD 64

Query: 182 DYS-VVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILVTLGMG 355
             + ++     TH P   +  P  +D  + KGL R    I +  DL + HLPIL+ + + 
Sbjct: 65  PMAEIIATGCATHFPHDTRKNPSAIDFSICKGLGRLEKRISSSADLSSDHLPILLEINLD 124

Query: 356 -----LTRVATSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQ 517
                L +   + L+   + ELFK  L     +  +    E ++DA    + +I+ + D+
Sbjct: 125 TSTLFLQKQNNNILKKTTNIELFKTVLERKILLNTEIRVAEDINDAINIFIKNIKDSADE 184

Query: 518 AT 523
           +T
Sbjct: 185 ST 186


>AY561850-2|AAS68534.1| 1080|Drosophila melanogaster pol protein
           protein.
          Length = 1080

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 14/182 (7%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG       G  L E     
Sbjct: 121 PPSLSWSPHHFTDVLNFAEKTLGGQTKFILCGDWNAKHRQWGCTRACQRGTALYEAVQAD 180

Query: 182 DYS-VVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILVTLGMG 355
             + ++     TH P   +  P  +D  + KGL R    I +  DL + HLPIL+ + + 
Sbjct: 181 PMAEIIATGCATHFPHDTRKNPSAIDFSICKGLGRLEKRISSSADLSSDHLPILLEINLD 240

Query: 356 -----LTRVATSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQ 517
                L +   + L+   + ELFK  L     +  +    E ++DA    + +I+ + D+
Sbjct: 241 TSTLFLQKQNNNILKKTTNIELFKTVLERKILLNTEIRVAEDINDAINIFIKNIKDSADE 300

Query: 518 AT 523
           +T
Sbjct: 301 ST 302


>AM040245-1|CAJ13341.1| 1042|Drosophila melanogaster pol protein
           protein.
          Length = 1042

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 49/182 (26%), Positives = 76/182 (41%), Gaps = 14/182 (7%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG       G  L E     
Sbjct: 83  PPSLSWSPHHFTDVLNFAEKTLGGQTKFILCGDWNAKHRQWGCTRACQRGTALYEAVQAD 142

Query: 182 DYS-VVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILV----- 340
             + ++     TH P   +  P  +D  + KGL R    I +  DL + HLPIL+     
Sbjct: 143 PMAEIIATGCATHFPHDTRKNPSAIDFSICKGLGRLEKRISSSADLSSDHLPILLEINLD 202

Query: 341 TLGMGLTRVATSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQ 517
           T  + L +   + L+   + ELFK  L     +  +    E ++DA    + +I+ + D+
Sbjct: 203 TSNLFLQKQNNNILKKTTNIELFKTVLERKILLNTEIRVAEDINDAINIFIKNIKDSADE 262

Query: 518 AT 523
           +T
Sbjct: 263 ST 264


>AJ566116-2|CAD92793.1| 1080|Drosophila melanogaster pol protein
           protein.
          Length = 1080

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 49/182 (26%), Positives = 76/182 (41%), Gaps = 14/182 (7%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG       G  L E     
Sbjct: 121 PPSLSWSPHHFTDVLNFAEKTLGGQTKFILCGDWNAKHRQWGCTRACQRGTALYEAVQAD 180

Query: 182 DYS-VVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILV----- 340
             + ++     TH P   +  P  +D  + KGL R    I +  DL + HLPIL+     
Sbjct: 181 PMAEIIATGCATHFPHDTRKNPSAIDFSICKGLGRLEKRISSSADLSSDHLPILLEINLD 240

Query: 341 TLGMGLTRVATSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQ 517
           T  + L +   + L+   + ELFK  L     +  +    E ++DA    + +I+ + D+
Sbjct: 241 TSNLFLQKQNNNILKKTTNIELFKTVLERKILLNTEIRVAEDINDAINIFIKNIKDSADE 300

Query: 518 AT 523
           +T
Sbjct: 301 ST 302


>U14101-2|AAC46494.1| 1084|Drosophila melanogaster putative reverse
           transcriptase protein.
          Length = 1084

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 41/154 (26%), Positives = 68/154 (44%), Gaps = 8/154 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYS-VVGPDEPTHIPTAAQLQPDVLDVC 262
           +L GD NAKH  WG       G  L E       + ++     TH P   +  P  +D  
Sbjct: 149 ILCGDWNAKHRQWGCTRACQRGTALYEAVQADSTAEIIATGCATHFPHDTRKNPSAIDFS 208

Query: 263 VHKGL-RCPLTIEALYDLGTPHLPILVTLGMG-----LTRVATSPLRPKVDWELFKRRLV 424
           + KGL R    I +  DL + HLPIL+ + +      L +   + L+   + ELFK+ L 
Sbjct: 209 ICKGLGRFEKRISSGADLSSDHLPILLEINLDTNTLFLQKQNNNILKKNTNIELFKKVLE 268

Query: 425 DLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQAT 523
               +  +    E ++DA    + +I+ +  ++T
Sbjct: 269 RKILLNTEIRVAEDINDAISTFMKNIKDSAAEST 302


>AY600955-2|AAT12845.1| 1092|Drosophila melanogaster pol protein
           protein.
          Length = 1092

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 15/183 (8%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG  + +      L DA + 
Sbjct: 133 PPSLSWSPHHFTDVLNFAEKTMGGQTKLILCGDWNAKHRQWGC-IRACQRGAALYDAIQA 191

Query: 182 D--YSVVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILVTLGM 352
           D    +V     TH P   +  P  +D  + K L R    I +   L + HLPIL+ + +
Sbjct: 192 DSMAEIVATGSATHFPHDTRKSPSAIDFSICKRLGRYEKRISSSAHLSSDHLPILLEINL 251

Query: 353 GLTRVA-----TSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAID 514
            +  ++      + L+   + ELFK  L     +  +    E ++DA    + +I+ +  
Sbjct: 252 DIKTISLQKQNNNILKKTTNIELFKNVLERKILLNTEIRVAEDINDAINIFIKNIKDSAA 311

Query: 515 QAT 523
           ++T
Sbjct: 312 EST 314


>AJ302712-2|CAC16871.1| 1227|Drosophila melanogaster pol protein.
          Length = 1227

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 3/135 (2%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   F   DI  +L   +   +L+GDLN+    WGS   +  G+++          V+ 
Sbjct: 109 PPSQIFSSSDISEILQNLNGSTILLGDLNSWSPLWGSPRTNTRGKKIETVILENSLIVLN 168

Query: 200 PDEPTHIPTAAQL-QPDVLDVCVHKGLRCPLTI-EALYDLGTPHLPILVTLGMGLTRVAT 373
              PTH+ T       D+  +       C  +I + L+  G+ H PI + +        T
Sbjct: 169 DGSPTHLSTHNTFTHIDISLISPQIAHMCSWSISDNLH--GSDHFPITIHINTPTRPDNT 226

Query: 374 SPL-RPKVDWELFKR 415
            PL + K D   +KR
Sbjct: 227 LPLPKYKTDQANWKR 241


>M38643-2|AAA28940.1|  192|Drosophila melanogaster protein (
           D.melanogaster mobileelement jockey gag-specific protein
           gene, complete cds.).
          Length = 192

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/65 (30%), Positives = 28/65 (43%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   +   D + +        +  GD NAKH  WG+  +   G+ L E    G Y V+ 
Sbjct: 112 PPAERWIVDDFKSMFAALGNKFIAGGDYNAKHAWWGNPRSCPRGKMLQEVIAHGQYQVLA 171

Query: 200 PDEPT 214
             EPT
Sbjct: 172 TGEPT 176


>M14954-2|AAA70222.2| 1219|Drosophila melanogaster putative ORF2
           protein.
          Length = 1219

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 1/100 (1%)
 Frame = +2

Query: 50  IRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTA 229
           +    N    P+L+ GD N  H  WGS   +  G+      D     ++    PTH  T 
Sbjct: 115 LHNTFNIQQTPSLITGDFNGWHHPWGSPTTNKRGKITHRFIDNMHLILLNDKSPTHFSTH 174

Query: 230 AQLQPDVLDVCVHKGLRCPLTIEALYDL-GTPHLPILVTL 346
                  L +C    L      + L DL G+ H PI+ TL
Sbjct: 175 NTYTHIDLTLC-SPILAPHAKWKILNDLHGSDHFPIITTL 213


>AJ278684-2|CAB99192.1|  989|Drosophila melanogaster
           endonuclease/reverse transcriptase protein.
          Length = 989

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/30 (43%), Positives = 21/30 (70%)
 Frame = +2

Query: 77  RPALLVGDLNAKHVAWGSRLNSAVGRRLLE 166
           RP ++ GDLNA    WGSR+++  GR +++
Sbjct: 118 RPTVIGGDLNAWATEWGSRISNTRGRAVID 147


>AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p
           protein.
          Length = 1193

 Score = 28.7 bits (61), Expect(2) = 0.85
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLAP 381
           PGYPP P  G  G    PG +  P
Sbjct: 382 PGYPPQPGAGFPGQPGRPGFNQPP 405



 Score = 21.4 bits (43), Expect(2) = 0.85
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +1

Query: 238 PARRVGCVRS*GATVPLNY*GTVRPGYPPSP 330
           P ++       GA  P  Y G  +PGYPP P
Sbjct: 335 PGQQAAAPPQFGAPQP-GYPGQ-QPGYPPQP 363


>AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA
           protein.
          Length = 1193

 Score = 28.7 bits (61), Expect(2) = 0.85
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLAP 381
           PGYPP P  G  G    PG +  P
Sbjct: 382 PGYPPQPGAGFPGQPGRPGFNQPP 405



 Score = 21.4 bits (43), Expect(2) = 0.85
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +1

Query: 238 PARRVGCVRS*GATVPLNY*GTVRPGYPPSP 330
           P ++       GA  P  Y G  +PGYPP P
Sbjct: 335 PGQQAAAPPQFGAPQP-GYPGQ-QPGYPPQP 363


>AY122174-1|AAM52686.1|  877|Drosophila melanogaster LD34142p
           protein.
          Length = 877

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPGCDLAP 381
           G++VP      +  G PP PY  H G+G +PG    P
Sbjct: 356 GSSVPNGPMSPMENGPPPPPYLRHNGSGYNPGAPPPP 392


>AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA,
            isoform A protein.
          Length = 2061

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 271  GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPGCDLAP 381
            G++VP      +  G PP PY  H G+G +PG    P
Sbjct: 1540 GSSVPNGPMSPMENGPPPPPYLRHNGSGYNPGAPPPP 1576


>AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB,
            isoform B protein.
          Length = 2103

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 271  GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPGCDLAP 381
            G++VP      +  G PP PY  H G+G +PG    P
Sbjct: 1582 GSSVPNGPMSPMENGPPPPPYLRHNGSGYNPGAPPPP 1618


>M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenless
            protein protein.
          Length = 1595

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 297  RHCTTWVPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*ST 428
            R C T VP     W H    SPG++PR  ++ ++ S L ++ S+
Sbjct: 1065 RGCKT-VPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSS 1107


>M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenless
            protein.
          Length = 1596

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 297  RHCTTWVPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*ST 428
            R C T VP     W H    SPG++PR  ++ ++ S L ++ S+
Sbjct: 1066 RGCKT-VPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSS 1108


>BT015294-1|AAT94523.1| 1596|Drosophila melanogaster GH01796p protein.
          Length = 1596

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 297  RHCTTWVPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*ST 428
            R C T VP     W H    SPG++PR  ++ ++ S L ++ S+
Sbjct: 1066 RGCKT-VPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSS 1108


>AY118400-1|AAM48429.1|  608|Drosophila melanogaster RE60058p
           protein.
          Length = 608

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 255 SNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           S+ SG+S  +    + S+GP +  SP  ASS++ L     +   H+   A  +P+  +G
Sbjct: 222 SSASGYSHYSKTSSISSNGPCSPASPAVASSSNHLAPPSPTTHHHSHSLASPTPSGSSG 280


>AL031863-1|CAA21315.1|  526|Drosophila melanogaster EG:EG0003.1
           protein.
          Length = 526

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 255 SNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           S+ SG+S  +    + S+GP +  SP  ASS++ L     +   H+   A  +P+  +G
Sbjct: 140 SSASGYSHYSKTSSISSNGPCSPASPAVASSSNHLAPPSPTTHHHSHSLASPTPSGSSG 198


>AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA
            protein.
          Length = 1596

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 297  RHCTTWVPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*ST 428
            R C T VP     W H    SPG++PR  ++ ++ S L ++ S+
Sbjct: 1066 RGCKT-VPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSS 1108


>AE013599-2369|AAF57936.2|  608|Drosophila melanogaster CG8910-PA
           protein.
          Length = 608

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 255 SNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           S+ SG+S  +    + S+GP +  SP  ASS++ L     +   H+   A  +P+  +G
Sbjct: 222 SSASGYSHYSKTSSISSNGPCSPASPAVASSSNHLAPPSPTTHHHSHSLASPTPSGSSG 280


>AY058772-1|AAL14001.1|  385|Drosophila melanogaster SD05480p
           protein.
          Length = 385

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +2

Query: 62  LNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD 205
           L C  + AL +   ++KH+       S       E+ DRGD+    PD
Sbjct: 34  LRCQRKLALKLKQKDSKHIGENGEKPSEDSEESKEEQDRGDFREEDPD 81


>AY051912-1|AAK93336.1|  801|Drosophila melanogaster LD39933p
           protein.
          Length = 801

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +2

Query: 62  LNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD 205
           L C  + AL +   ++KH+       S       E+ DRGD+    PD
Sbjct: 474 LRCQRKLALKLKQKDSKHIGENGEKPSEDSEESKEEQDRGDFREEDPD 521


>AE014134-2350|AAF53302.2|  800|Drosophila melanogaster CG7110-PB
           protein.
          Length = 800

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +2

Query: 62  LNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD 205
           L C  + AL +   ++KH+       S       E+ DRGD+    PD
Sbjct: 474 LRCQRKLALKLKQKDSKHIGENGEKPSEDSEESKEEQDRGDFREEDPD 521


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,706,499
Number of Sequences: 53049
Number of extensions: 790572
Number of successful extensions: 2833
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 2413
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2797
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2338128087
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).