SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   301   8e-82
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   301   8e-82
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   301   8e-82
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   301   8e-82
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   301   8e-82
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   299   2e-81
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   299   2e-81
K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   298   4e-81
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   293   2e-79
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   293   2e-79
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   293   2e-79
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    293   2e-79
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   290   1e-78
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   290   1e-78
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   290   1e-78
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   290   1e-78
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   290   1e-78
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   290   1e-78
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   290   1e-78
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   290   1e-78
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   287   8e-78
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   287   8e-78
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   287   8e-78
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   287   8e-78
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   287   8e-78
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   286   2e-77
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   286   2e-77
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   197   1e-50
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   197   1e-50
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   196   3e-50
X54848-1|CAA38618.1|  100|Drosophila melanogaster Actin protein.      189   4e-48
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   164   9e-41
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   164   1e-40
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   164   1e-40
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...   131   8e-31
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...   131   8e-31
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...   131   8e-31
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...   122   5e-28
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...   122   5e-28
X06384-1|CAB61444.1|   53|Drosophila melanogaster protein ( Dros...   116   3e-26
K02065-1|AAA28322.1|   55|Drosophila melanogaster protein ( D. m...   114   1e-25
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    89   4e-18
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    89   4e-18
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    89   4e-18
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    86   5e-17
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    86   5e-17
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    86   5e-17
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    67   3e-11
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    67   3e-11
AY051720-1|AAK93144.1|  607|Drosophila melanogaster LD24980p pro...    40   0.003
AE014298-2624|AAF48774.1|  607|Drosophila melanogaster CG7846-PA...    40   0.003
AY051833-1|AAK93257.1|  378|Drosophila melanogaster LD33759p pro...    38   0.018
AE014298-2904|AAF48994.1|  378|Drosophila melanogaster CG12235-P...    38   0.018
AY119457-1|AAM50111.1|  443|Drosophila melanogaster GH01258p pro...    31   2.1  
AE014298-732|AAF46027.3|  809|Drosophila melanogaster CG10706-PB...    31   2.1  
AE014298-731|AAF46029.3|  809|Drosophila melanogaster CG10706-PA...    31   2.1  
AE014298-730|AAS65264.1|  924|Drosophila melanogaster CG10706-PF...    31   2.1  
AE014298-729|AAN09136.2|  924|Drosophila melanogaster CG10706-PC...    31   2.1  
BT021227-1|AAX33375.1|  124|Drosophila melanogaster RH43429p pro...    29   4.8  
AE014296-865|AAF47915.2|  585|Drosophila melanogaster CG32242-PA...    29   6.3  

>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  301 bits (738), Expect = 8e-82
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  301 bits (738), Expect = 8e-82
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  301 bits (738), Expect = 8e-82
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  301 bits (738), Expect = 8e-82
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  301 bits (738), Expect = 8e-82
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  299 bits (734), Expect = 2e-81
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  299 bits (734), Expect = 2e-81
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  298 bits (732), Expect = 4e-81
 Identities = 137/140 (97%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMEACG+HETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGLHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  293 bits (719), Expect = 2e-79
 Identities = 136/140 (97%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALF PSFLGME+CGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFHPSFLGMESCGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS STFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASSSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           W SKQEYDESGPSIVHRKCF
Sbjct: 357 WTSKQEYDESGPSIVHRKCF 376


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  293 bits (718), Expect = 2e-79
 Identities = 135/140 (96%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N+VLSGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NSVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  293 bits (718), Expect = 2e-79
 Identities = 135/140 (96%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N+VLSGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NSVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  293 bits (718), Expect = 2e-79
 Identities = 135/140 (96%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N+VLSGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NSVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  290 bits (712), Expect = 1e-78
 Identities = 134/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N+VLSGGTTMYPGIADRMQKEIT LAPST+KIKIIAPPERKYSVWIGG ILASLSTFQQM
Sbjct: 297 NSVLSGGTTMYPGIADRMQKEITTLAPSTIKIKIIAPPERKYSVWIGGLILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 202 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 261

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 262 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 321

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 322 WISKQEYDESGPGIVHRKCF 341


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  290 bits (711), Expect = 1e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  287 bits (705), Expect = 8e-78
 Identities = 134/140 (95%), Positives = 135/140 (96%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFR PEALFQPSFLGME+CGIHET Y SIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  287 bits (705), Expect = 8e-78
 Identities = 134/140 (95%), Positives = 135/140 (96%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFR PEALFQPSFLGME+CGIHET Y SIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  287 bits (705), Expect = 8e-78
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK+EYDESGP IVHRKCF
Sbjct: 357 WISKEEYDESGPGIVHRKCF 376


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  287 bits (705), Expect = 8e-78
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 221 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 280

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 281 NIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 340

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK+EYDESGP IVHRKCF
Sbjct: 341 WISKEEYDESGPGIVHRKCF 360


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  287 bits (705), Expect = 8e-78
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK+EYDESGP IVHRKCF
Sbjct: 357 WISKEEYDESGPGIVHRKCF 376


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  286 bits (701), Expect = 2e-77
 Identities = 133/140 (95%), Positives = 135/140 (96%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFR PEALFQPSFLGME+CGIHET Y SIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  286 bits (701), Expect = 2e-77
 Identities = 133/140 (95%), Positives = 135/140 (96%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFR PEALFQPSFLGME+CGIHET Y SIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IVHRKCF
Sbjct: 357 WISKQEYDESGPGIVHRKCF 376


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  197 bits (480), Expect = 1e-50
 Identities = 85/138 (61%), Positives = 110/138 (79%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           ++YELPDGQ I +G ERFRCPEALFQPS LG E  GIHE T++SI  CD+D+RKD+YAN 
Sbjct: 239 ETYELPDGQKIVLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANI 298

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTTM+  I  R  +++T +AP +++IK+ A P+R++SVW GGS+LASL++FQ MWI
Sbjct: 299 VLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWI 358

Query: 340 SKQEYDESGPSIVHRKCF 287
              EY+E G +IVHRKCF
Sbjct: 359 DSLEYEEVGSAIVHRKCF 376


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  197 bits (480), Expect = 1e-50
 Identities = 85/138 (61%), Positives = 110/138 (79%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           ++YELPDGQ I +G ERFRCPEALFQPS LG E  GIHE T++SI  CD+D+RKD+YAN 
Sbjct: 239 ETYELPDGQKIVLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANI 298

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTTM+  I  R  +++T +AP +++IK+ A P+R++SVW GGS+LASL++FQ MWI
Sbjct: 299 VLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWI 358

Query: 340 SKQEYDESGPSIVHRKCF 287
              EY+E G +IVHRKCF
Sbjct: 359 DSLEYEEVGSAIVHRKCF 376


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  196 bits (477), Expect = 3e-50
 Identities = 84/138 (60%), Positives = 110/138 (79%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           ++YELPDGQ I +G ERFRCPEALFQPS LG E  GIHE T++SI  CD+D+RKD+YAN 
Sbjct: 231 ETYELPDGQKIVLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANI 290

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++  I  R  +++T +AP +++IK+ A P+R++SVW GGS+LASL++FQ MWI
Sbjct: 291 VLSGGTTLFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWI 350

Query: 340 SKQEYDESGPSIVHRKCF 287
              EY+E G +IVHRKCF
Sbjct: 351 DSLEYEEVGSAIVHRKCF 368


>X54848-1|CAA38618.1|  100|Drosophila melanogaster Actin protein.
          Length = 100

 Score =  189 bits (460), Expect = 4e-48
 Identities = 88/89 (98%), Positives = 89/89 (100%)
 Frame = -3

Query: 553 VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 374
           VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSIL
Sbjct: 12  VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSIL 71

Query: 373 ASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           ASLSTFQQMWISKQEYDESGPSIVHRKCF
Sbjct: 72  ASLSTFQQMWISKQEYDESGPSIVHRKCF 100


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  164 bits (399), Expect = 9e-41
 Identities = 75/137 (54%), Positives = 97/137 (70%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG++  IG  RFR PEA+F+P  LG E  GIH+    SI K D+D+RK LY N V
Sbjct: 240 AYKLPDGKIFEIGPARFRAPEAVFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGG+T++ G  DR+  E+   +   +KI+I AP ER YS W+GGSILASL TF++MWIS
Sbjct: 300 LSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWIS 359

Query: 337 KQEYDESGPSIVHRKCF 287
           K+EY+E G   VHRK F
Sbjct: 360 KREYEEEGQKAVHRKTF 376


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  164 bits (398), Expect = 1e-40
 Identities = 75/137 (54%), Positives = 96/137 (70%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG++  IG  RFR PE LF+P  LG E  GIH+    SI K D+D+RK LY N V
Sbjct: 240 AYKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGG+T++ G  DR+  E+   +   +KI+I AP ER YS W+GGSILASL TF++MWIS
Sbjct: 300 LSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWIS 359

Query: 337 KQEYDESGPSIVHRKCF 287
           K+EY+E G   VHRK F
Sbjct: 360 KREYEEEGQKAVHRKTF 376


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  164 bits (398), Expect = 1e-40
 Identities = 75/137 (54%), Positives = 96/137 (70%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG++  IG  RFR PE LF+P  LG E  GIH+    SI K D+D+RK LY N V
Sbjct: 240 AYKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGG+T++ G  DR+  E+   +   +KI+I AP ER YS W+GGSILASL TF++MWIS
Sbjct: 300 LSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWIS 359

Query: 337 KQEYDESGPSIVHRKCF 287
           K+EY+E G   VHRK F
Sbjct: 360 KREYEEEGQKAVHRKTF 376


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score =  131 bits (317), Expect = 8e-31
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG+VI +G ERF  PEALFQP  + +E  GI E  +N+I   D+DIR +LY 
Sbjct: 241 LVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYK 300

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++EI  L             +  KI+I  PP RK  V+IGG+
Sbjct: 301 HIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGA 360

Query: 379 ILASLSTFQQ-MWISKQEYDESGPSIVHR 296
           +LA ++  +   W+SKQEY E G  ++ +
Sbjct: 361 VLAEVTKDRDGFWMSKQEYQEQGLKVLQK 389


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score =  131 bits (317), Expect = 8e-31
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG+VI +G ERF  PEALFQP  + +E  GI E  +N+I   D+DIR +LY 
Sbjct: 240 LVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++EI  L             +  KI+I  PP RK  V+IGG+
Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGA 359

Query: 379 ILASLSTFQQ-MWISKQEYDESGPSIVHR 296
           +LA ++  +   W+SKQEY E G  ++ +
Sbjct: 360 VLAEVTKDRDGFWMSKQEYQEQGLKVLQK 388


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score =  131 bits (317), Expect = 8e-31
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG+VI +G ERF  PEALFQP  + +E  GI E  +N+I   D+DIR +LY 
Sbjct: 240 LVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++EI  L             +  KI+I  PP RK  V+IGG+
Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGA 359

Query: 379 ILASLSTFQQ-MWISKQEYDESGPSIVHR 296
           +LA ++  +   W+SKQEY E G  ++ +
Sbjct: 360 VLAEVTKDRDGFWMSKQEYQEQGLKVLQK 388


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score =  122 bits (294), Expect = 5e-28
 Identities = 59/138 (42%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           YE P+G     G+ERF+  E+LF  + LG       +    S+  CD D+R  L+ + V+
Sbjct: 292 YEFPNGYHQDFGSERFKIAESLFDNAMLGAG-----QLASTSVGMCDADVRLSLFGSVVV 346

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMW 344
           +GG T+  G  +R+ +++   APS  ++K+I+     ER++  WIGGSILAS+ TFQQMW
Sbjct: 347 TGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILASIGTFQQMW 406

Query: 343 ISKQEYDESGPSIVHRKC 290
           IS QEY+E+G S V RKC
Sbjct: 407 ISSQEYEEAGKSQVERKC 424


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score =  122 bits (294), Expect = 5e-28
 Identities = 59/138 (42%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           YE P+G     G+ERF+  E+LF  + LG       +    S+  CD D+R  L+ + V+
Sbjct: 292 YEFPNGYHQDFGSERFKIAESLFDNAMLGAG-----QLASTSVGMCDADVRLSLFGSVVV 346

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMW 344
           +GG T+  G  +R+ +++   APS  ++K+I+     ER++  WIGGSILAS+ TFQQMW
Sbjct: 347 TGGNTLLQGFPERLNRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILASIGTFQQMW 406

Query: 343 ISKQEYDESGPSIVHRKC 290
           IS QEY+E+G S V RKC
Sbjct: 407 ISSQEYEEAGKSQVERKC 424


>X06384-1|CAB61444.1|   53|Drosophila melanogaster protein (
           Drosophila 5C actingene 3' region (exon 3 part.). ).
          Length = 53

 Score =  116 bits (279), Expect = 3e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = -3

Query: 445 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
Sbjct: 1   STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 53


>K02065-1|AAA28322.1|   55|Drosophila melanogaster protein ( D.
           melanogaster (mutantIfm(3)7) act88F actin gene, 3' end.
           ).
          Length = 55

 Score =  114 bits (275), Expect = 1e-25
 Identities = 54/55 (98%), Positives = 55/55 (100%)
 Frame = -3

Query: 511 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           GGTTMYPGIADRMQKEITALAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 1   GGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQM 55


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 36/121 (29%), Positives = 70/121 (57%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++++ NERF  PE LF PS +G++  GI E   + +  C  +  ++L  N ++ GG+  
Sbjct: 271 QMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQ 330

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+++++ AL P  +++ +I P +     W GG  +A+   F++   ++ +Y+E 
Sbjct: 331 FPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEY 390

Query: 316 G 314
           G
Sbjct: 391 G 391


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 36/121 (29%), Positives = 70/121 (57%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++++ NERF  PE LF PS +G++  GI E   + +  C  +  ++L  N ++ GG+  
Sbjct: 271 QMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQ 330

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+++++ AL P  +++ +I P +     W GG  +A+   F++   ++ +Y+E 
Sbjct: 331 FPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEY 390

Query: 316 G 314
           G
Sbjct: 391 G 391


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 36/121 (29%), Positives = 70/121 (57%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++++ NERF  PE LF PS +G++  GI E   + +  C  +  ++L  N ++ GG+  
Sbjct: 271 QMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQ 330

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+++++ AL P  +++ +I P +     W GG  +A+   F++   ++ +Y+E 
Sbjct: 331 FPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEY 390

Query: 316 G 314
           G
Sbjct: 391 G 391


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 18/148 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +G ERF  PE  F P F   +    + E   N I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q++I                  + P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 KDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSIV-HRKCF*T 281
            F Q+  +K  Y+E GPSI  H   F T
Sbjct: 389 EFYQVCHTKAAYEEYGPSICRHNPVFGT 416


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 18/148 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +G ERF  PE  F P F   +    + E   N I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q++I                  + P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 KDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSIV-HRKCF*T 281
            F Q+  +K  Y+E GPSI  H   F T
Sbjct: 389 EFYQVCHTKAAYEEYGPSICRHNPVFGT 416


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 18/148 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +G ERF  PE  F P F   +    + E   N I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q++I                  + P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 KDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSIV-HRKCF*T 281
            F Q+  +K  Y+E GPSI  H   F T
Sbjct: 389 EFYQVCHTKAAYEEYGPSICRHNPVFGT 416


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 40/131 (30%), Positives = 60/131 (45%)
 Frame = -3

Query: 661 GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIA 482
           G E  R PE LFQPS +G    G+ E     +       ++ L  +  L+GG   + G+ 
Sbjct: 514 GVENIRVPEVLFQPSMIGCSEAGLAELIAFVLKLFPAAEQQRLVEHVYLTGGCAQFKGLK 573

Query: 481 DRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +R+ KE+  + P   K  I    E   S W+G  + A   TF Q   ++Q++ E G    
Sbjct: 574 ERLIKELMEMRPFQSKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHG---- 629

Query: 301 HRKCF*THRAS 269
            R+ F  H AS
Sbjct: 630 -REFFREHTAS 639


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 40/131 (30%), Positives = 60/131 (45%)
 Frame = -3

Query: 661 GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIA 482
           G E  R PE LFQPS +G    G+ E     +       ++ L  +  L+GG   + G+ 
Sbjct: 514 GVENIRVPEVLFQPSMIGCSEAGLAELIAFVLKLFPAAEQQRLVEHVYLTGGCAQFKGLK 573

Query: 481 DRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +R+ KE+  + P   K  I    E   S W+G  + A   TF Q   ++Q++ E G    
Sbjct: 574 ERLIKELMEMRPFQSKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHG---- 629

Query: 301 HRKCF*THRAS 269
            R+ F  H AS
Sbjct: 630 -REFFREHTAS 639


>AY051720-1|AAK93144.1|  607|Drosophila melanogaster LD24980p
           protein.
          Length = 607

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 16/86 (18%), Positives = 46/86 (53%)
 Frame = -3

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 371
           + ++ ++ + +L G +   PG+A  +++ I+    S + + +I   +     W G +I++
Sbjct: 518 ETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNV-LIKGMDAGMVAWKGAAIMS 576

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRK 293
            L + +++WIS+ ++   G  ++  +
Sbjct: 577 VLESARELWISQNDWQRHGLRVLRER 602


>AE014298-2624|AAF48774.1|  607|Drosophila melanogaster CG7846-PA
           protein.
          Length = 607

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 16/86 (18%), Positives = 46/86 (53%)
 Frame = -3

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 371
           + ++ ++ + +L G +   PG+A  +++ I+    S + + +I   +     W G +I++
Sbjct: 518 ETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNV-LIKGMDAGMVAWKGAAIMS 576

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRK 293
            L + +++WIS+ ++   G  ++  +
Sbjct: 577 VLESARELWISQNDWQRHGLRVLRER 602


>AY051833-1|AAK93257.1|  378|Drosophila melanogaster LD33759p
           protein.
          Length = 378

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 11/96 (11%)
 Frame = -3

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPST----------MKIKII 422
           SI+ C +D+R+ L  +  L GG +M  G+  R+++E+  L              ++ K  
Sbjct: 266 SILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFF 325

Query: 421 -APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
            A  ++ ++ W+GG++  +    Q   + K+ Y +S
Sbjct: 326 NAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361


>AE014298-2904|AAF48994.1|  378|Drosophila melanogaster CG12235-PA
           protein.
          Length = 378

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 11/96 (11%)
 Frame = -3

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPST----------MKIKII 422
           SI+ C +D+R+ L  +  L GG +M  G+  R+++E+  L              ++ K  
Sbjct: 266 SILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFF 325

Query: 421 -APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
            A  ++ ++ W+GG++  +    Q   + K+ Y +S
Sbjct: 326 NAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361


>AY119457-1|AAM50111.1|  443|Drosophila melanogaster GH01258p
           protein.
          Length = 443

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 408 GSTPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP--LYTGSASKRTARRCLQQPAAGCSI 235
           G++ Y ++  S PPS+PS     RN S  +   P  L   SAS+ + +   QQ     S+
Sbjct: 202 GTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLIDRSASRDSVKSAFQQGNLSGSM 261

Query: 234 QAC 226
             C
Sbjct: 262 AIC 264


>AE014298-732|AAF46027.3|  809|Drosophila melanogaster CG10706-PB,
           isoform B protein.
          Length = 809

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 408 GSTPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP--LYTGSASKRTARRCLQQPAAGCSI 235
           G++ Y ++  S PPS+PS     RN S  +   P  L   SAS+ + +   QQ     S+
Sbjct: 202 GTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLIDRSASRDSVKSAFQQGNLSGSM 261

Query: 234 QAC 226
             C
Sbjct: 262 AIC 264


>AE014298-731|AAF46029.3|  809|Drosophila melanogaster CG10706-PA,
           isoform A protein.
          Length = 809

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 408 GSTPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP--LYTGSASKRTARRCLQQPAAGCSI 235
           G++ Y ++  S PPS+PS     RN S  +   P  L   SAS+ + +   QQ     S+
Sbjct: 202 GTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLIDRSASRDSVKSAFQQGNLSGSM 261

Query: 234 QAC 226
             C
Sbjct: 262 AIC 264


>AE014298-730|AAS65264.1|  924|Drosophila melanogaster CG10706-PF,
           isoform F protein.
          Length = 924

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 408 GSTPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP--LYTGSASKRTARRCLQQPAAGCSI 235
           G++ Y ++  S PPS+PS     RN S  +   P  L   SAS+ + +   QQ     S+
Sbjct: 202 GTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLIDRSASRDSVKSAFQQGNLSGSM 261

Query: 234 QAC 226
             C
Sbjct: 262 AIC 264


>AE014298-729|AAN09136.2|  924|Drosophila melanogaster CG10706-PC,
           isoform C protein.
          Length = 924

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 408 GSTPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP--LYTGSASKRTARRCLQQPAAGCSI 235
           G++ Y ++  S PPS+PS     RN S  +   P  L   SAS+ + +   QQ     S+
Sbjct: 202 GTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLIDRSASRDSVKSAFQQGNLSGSM 261

Query: 234 QAC 226
             C
Sbjct: 262 AIC 264


>BT021227-1|AAX33375.1|  124|Drosophila melanogaster RH43429p
           protein.
          Length = 124

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +1

Query: 478 GRRFQGTWWYHRTI--RCWRTSPYGCPRRTS*WSYMWSRGCRK 600
           G R   +WW  R    R WR S +   RR S WS  + R C++
Sbjct: 20  GGRSGTSWWIRRIRWRRWWRWSRWRRWRRWSRWSRRFERSCQR 62


>AE014296-865|AAF47915.2|  585|Drosophila melanogaster CG32242-PA
           protein.
          Length = 585

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 8/55 (14%)
 Frame = -1

Query: 399 PYGSVDRSSPPSLPSNR-CGSRNR-------STTSLAPPLYTGSASKRTARRCLQ 259
           P G+   +SPPS P NR  GS++R       +TT+    + TGSAS  +  R  Q
Sbjct: 388 PPGAPPTASPPSSPVNRQGGSKSRPRFYAPPATTTTNTAVVTGSASSLSTERTTQ 442


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,255,929
Number of Sequences: 53049
Number of extensions: 742185
Number of successful extensions: 2283
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 2173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2266
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3190721655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).