SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p pro...    29   4.6  
AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-P...    29   4.6  
AY119617-1|AAM50271.1|  462|Drosophila melanogaster LD44530p pro...    29   6.1  
AY058322-1|AAL13551.1|  684|Drosophila melanogaster GH09291p pro...    29   6.1  
AJ577475-1|CAE12059.1| 1342|Drosophila melanogaster polo kinase ...    29   6.1  
AE014297-3736|AAF56416.3|  993|Drosophila melanogaster CG13654-P...    29   6.1  
AE013599-3861|AAM68311.1| 1300|Drosophila melanogaster CG4527-PA...    29   6.1  
AE013599-3860|AAS64767.1| 1703|Drosophila melanogaster CG4527-PD...    29   6.1  
AE013599-3859|AAS64766.1| 1703|Drosophila melanogaster CG4527-PC...    29   6.1  
AE013599-3858|AAF47198.2| 1703|Drosophila melanogaster CG4527-PB...    29   6.1  
AE013599-3857|AAX52684.1| 1342|Drosophila melanogaster CG4527-PE...    29   6.1  

>BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p
           protein.
          Length = 2286

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = +3

Query: 459 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 560
           R+ FS  +  WNY  CW   C   P+  R N+  +L
Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362


>AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-PA
           protein.
          Length = 2286

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = +3

Query: 459 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 560
           R+ FS  +  WNY  CW   C   P+  R N+  +L
Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362


>AY119617-1|AAM50271.1|  462|Drosophila melanogaster LD44530p
           protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305 LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
           L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 246 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 290


>AY058322-1|AAL13551.1|  684|Drosophila melanogaster GH09291p
           protein.
          Length = 684

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305 LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
           L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 468 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 512


>AJ577475-1|CAE12059.1| 1342|Drosophila melanogaster polo kinase
            kinase 1 protein.
          Length = 1342

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


>AE014297-3736|AAF56416.3|  993|Drosophila melanogaster CG13654-PA
           protein.
          Length = 993

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 635 YPLPARGGSDEKYRYGTLTRPRNRNEYTLNI-LTRNNWRASL 513
           YPL   GG+D  + +GT+ RP    E ++   +  N+W  +L
Sbjct: 356 YPL---GGTDHNHGHGTIIRPNQTTEISIQFGVQPNSWHYAL 394


>AE013599-3861|AAM68311.1| 1300|Drosophila melanogaster CG4527-PA,
            isoform A protein.
          Length = 1300

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


>AE013599-3860|AAS64767.1| 1703|Drosophila melanogaster CG4527-PD,
            isoform D protein.
          Length = 1703

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


>AE013599-3859|AAS64766.1| 1703|Drosophila melanogaster CG4527-PC,
            isoform C protein.
          Length = 1703

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


>AE013599-3858|AAF47198.2| 1703|Drosophila melanogaster CG4527-PB,
            isoform B protein.
          Length = 1703

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


>AE013599-3857|AAX52684.1| 1342|Drosophila melanogaster CG4527-PE,
            isoform E protein.
          Length = 1342

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 305  LTEEHRDRILILNRRFLERRLTDDMLRKRVSITADAVHRQRGAQMQL 445
            L+E+HRD +  +NR FL+++   + +R R ++  +   +Q   + QL
Sbjct: 1084 LSEKHRDHLATINRNFLQQK--QNAMRTREALLWELEEKQLHERHQL 1128


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,042,541
Number of Sequences: 53049
Number of extensions: 606823
Number of successful extensions: 1398
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1355
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1398
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).