SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070991-1|AAL48613.1|  148|Drosophila melanogaster RE08270p pro...   123   3e-28
AE013599-2306|AAM68504.1|  147|Drosophila melanogaster CG8332-PB...   123   3e-28
AE013599-2305|AAF57984.1|  148|Drosophila melanogaster CG8332-PA...   123   3e-28
AY058318-1|AAL13547.1|  872|Drosophila melanogaster GH08353p pro...    33   0.75 
AE014296-3271|AAF49077.2|  872|Drosophila melanogaster CG14183-P...    33   0.75 

>AY070991-1|AAL48613.1|  148|Drosophila melanogaster RE08270p
           protein.
          Length = 148

 Score =  123 bits (297), Expect = 3e-28
 Identities = 57/76 (75%), Positives = 63/76 (82%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           + QL+ELMH         GLKRKPMAL+KKLR+AKKEAPPNEKPEIVKTHLRNMIIVPEM
Sbjct: 33  NNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEM 92

Query: 635 VGSIVGIYNGKTFNQV 682
            GSI+G+YNGK F QV
Sbjct: 93  TGSIIGVYNGKDFGQV 108



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/29 (89%), Positives = 27/29 (93%)
 Frame = +3

Query: 156 QVDETLKKKRIFRKFTYRGVDLDQLLDMP 242
           QVDE LKKKR F+KFTYRGVDLDQLLDMP
Sbjct: 4   QVDENLKKKRTFKKFTYRGVDLDQLLDMP 32


>AE013599-2306|AAM68504.1|  147|Drosophila melanogaster CG8332-PB,
           isoform B protein.
          Length = 147

 Score =  123 bits (297), Expect = 3e-28
 Identities = 57/76 (75%), Positives = 63/76 (82%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           + QL+ELMH         GLKRKPMAL+KKLR+AKKEAPPNEKPEIVKTHLRNMIIVPEM
Sbjct: 32  NNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEM 91

Query: 635 VGSIVGIYNGKTFNQV 682
            GSI+G+YNGK F QV
Sbjct: 92  TGSIIGVYNGKDFGQV 107



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/29 (89%), Positives = 27/29 (93%)
 Frame = +3

Query: 156 QVDETLKKKRIFRKFTYRGVDLDQLLDMP 242
           QVDE LKKKR F+KFTYRGVDLDQLLDMP
Sbjct: 3   QVDENLKKKRTFKKFTYRGVDLDQLLDMP 31


>AE013599-2305|AAF57984.1|  148|Drosophila melanogaster CG8332-PA,
           isoform A protein.
          Length = 148

 Score =  123 bits (297), Expect = 3e-28
 Identities = 57/76 (75%), Positives = 63/76 (82%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           + QL+ELMH         GLKRKPMAL+KKLR+AKKEAPPNEKPEIVKTHLRNMIIVPEM
Sbjct: 33  NNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEM 92

Query: 635 VGSIVGIYNGKTFNQV 682
            GSI+G+YNGK F QV
Sbjct: 93  TGSIIGVYNGKDFGQV 108



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/29 (89%), Positives = 27/29 (93%)
 Frame = +3

Query: 156 QVDETLKKKRIFRKFTYRGVDLDQLLDMP 242
           QVDE LKKKR F+KFTYRGVDLDQLLDMP
Sbjct: 4   QVDENLKKKRTFKKFTYRGVDLDQLLDMP 32


>AY058318-1|AAL13547.1|  872|Drosophila melanogaster GH08353p
           protein.
          Length = 872

 Score = 32.7 bits (71), Expect = 0.75
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +2

Query: 533 LVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVRKSQIL 700
           L+KK  R KK  PP EK    K +    ++  E+V  +  IY+  TF QV+K  ++
Sbjct: 20  LIKKQNRLKKIEPPEEKAVSYKIYAELYVLYVELVNKLSFIYH-NTF-QVQKRALV 73


>AE014296-3271|AAF49077.2|  872|Drosophila melanogaster CG14183-PA
           protein.
          Length = 872

 Score = 32.7 bits (71), Expect = 0.75
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +2

Query: 533 LVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVRKSQIL 700
           L+KK  R KK  PP EK    K +    ++  E+V  +  IY+  TF QV+K  ++
Sbjct: 20  LIKKQNRLKKIEPPEEKAVSYKIYAELYVLYVELVNKLSFIYH-NTF-QVQKRALV 73


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,292,405
Number of Sequences: 53049
Number of extensions: 677988
Number of successful extensions: 1363
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1318
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1363
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4689737487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).