SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   189   3e-48
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   189   3e-48
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   189   3e-48
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   189   3e-48
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   189   3e-48
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   189   3e-48
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   189   3e-48
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   189   3e-48
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   189   3e-48
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   187   9e-48
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   187   9e-48
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   187   9e-48
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    187   9e-48
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   187   1e-47
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   187   1e-47
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   187   1e-47
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   186   2e-47
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   186   2e-47
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   186   2e-47
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   186   2e-47
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   186   2e-47
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   186   2e-47
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   185   4e-47
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   185   4e-47
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   185   4e-47
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   185   4e-47
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   131   6e-31
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   128   4e-30
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   128   4e-30
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   125   4e-29
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   116   2e-26
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   112   3e-25
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   112   3e-25
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   112   3e-25
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...   101   6e-22
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...   101   8e-22
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...   101   8e-22
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    95   5e-20
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    94   1e-19
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    94   1e-19
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    69   5e-12
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    69   5e-12
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    55   7e-08
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    55   7e-08
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    38   0.011
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    38   0.011
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    38   0.011
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.54 
BT003217-1|AAO24972.1|  824|Drosophila melanogaster RE10170p pro...    31   1.6  
AE013599-1060|AAF58815.2|  811|Drosophila melanogaster CG18408-P...    31   1.6  
AE013599-1059|AAM68778.1|  824|Drosophila melanogaster CG18408-P...    31   1.6  
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   3.8  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   3.8  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   3.8  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   3.8  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   3.8  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   3.8  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   3.8  
AY089305-1|AAL90043.1|  453|Drosophila melanogaster AT10573p pro...    26   4.7  
AE014134-1535|AAF52691.1|  453|Drosophila melanogaster CG13090-P...    26   4.7  
AY089302-1|AAL90040.1|  349|Drosophila melanogaster AT10149p pro...    29   5.0  
AE014298-3172|AAF50954.1|  395|Drosophila melanogaster CG14620-P...    29   5.0  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   8.7  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   8.7  
BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro...    28   8.7  
BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro...    28   8.7  
BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro...    28   8.7  
BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro...    28   8.7  
BT010216-1|AAQ23534.1|  366|Drosophila melanogaster RH40749p pro...    28   8.7  
AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791...    28   8.7  
AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD...    28   8.7  
AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC...    28   8.7  
AE014297-4062|AAF56660.2|  366|Drosophila melanogaster CG6131-PA...    28   8.7  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  189 bits (460), Expect = 3e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  187 bits (456), Expect = 9e-48
 Identities = 93/124 (75%), Positives = 98/124 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI 
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY 167

Query: 597 RKGF 608
            +GF
Sbjct: 168 -EGF 170



 Score =  110 bits (265), Expect = 1e-24
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  187 bits (456), Expect = 9e-48
 Identities = 93/124 (75%), Positives = 98/124 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI 
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY 167

Query: 597 RKGF 608
            +GF
Sbjct: 168 -EGF 170



 Score =  110 bits (265), Expect = 1e-24
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  187 bits (456), Expect = 9e-48
 Identities = 93/124 (75%), Positives = 98/124 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI 
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY 167

Query: 597 RKGF 608
            +GF
Sbjct: 168 -EGF 170



 Score =  110 bits (265), Expect = 1e-24
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  187 bits (456), Expect = 9e-48
 Identities = 93/124 (75%), Positives = 98/124 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI 
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY 167

Query: 597 RKGF 608
            +GF
Sbjct: 168 -EGF 170



 Score =  110 bits (265), Expect = 1e-24
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  187 bits (455), Expect = 1e-47
 Identities = 91/119 (76%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  187 bits (455), Expect = 1e-47
 Identities = 91/119 (76%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 33  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 92

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 93  APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 150



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = +1

Query: 142 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 37


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  187 bits (455), Expect = 1e-47
 Identities = 91/119 (76%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  186 bits (454), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  115 bits (277), Expect = 4e-26
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  185 bits (451), Expect = 4e-47
 Identities = 89/119 (74%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  112 bits (269), Expect = 4e-25
 Identities = 50/52 (96%), Positives = 51/52 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 52


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  185 bits (451), Expect = 4e-47
 Identities = 89/119 (74%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  112 bits (269), Expect = 4e-25
 Identities = 50/52 (96%), Positives = 51/52 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 52


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  185 bits (451), Expect = 4e-47
 Identities = 89/119 (74%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  112 bits (269), Expect = 4e-25
 Identities = 50/52 (96%), Positives = 51/52 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 52


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  185 bits (451), Expect = 4e-47
 Identities = 89/119 (74%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  112 bits (269), Expect = 4e-25
 Identities = 50/52 (96%), Positives = 51/52 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 52


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  131 bits (317), Expect = 6e-31
 Identities = 69/120 (57%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           ++G+    KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNP
Sbjct: 59  VIGERQPEKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNP 117

Query: 432 KANREKMTQIMFETFNTPAMYVAIQA-CSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           K NREKMT+IMFE F  PA YVA+QA  S CT      +    SGD G+ H  PI  +GF
Sbjct: 118 KKNREKMTEIMFEHFQVPAFYVAVQAVLSLCTTGRTVGIVV-DSGD-GVTHTVPIY-EGF 174



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 29/40 (72%), Positives = 36/40 (90%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 231
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLL 51


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  128 bits (310), Expect = 4e-30
 Identities = 67/119 (56%), Positives = 78/119 (65%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           ++G+ A  KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNP
Sbjct: 51  VIGEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNP 109

Query: 432 KANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           K NREKMT+IMFE F  PA YVA+QA                SGD G+ H  PI  +GF
Sbjct: 110 KKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGD-GVTHTVPIY-EGF 166



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 29/40 (72%), Positives = 36/40 (90%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 231
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLL 43


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  128 bits (310), Expect = 4e-30
 Identities = 67/119 (56%), Positives = 78/119 (65%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           ++G+ A  KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNP
Sbjct: 59  VIGEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNP 117

Query: 432 KANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           K NREKMT+IMFE F  PA YVA+QA                SGD G+ H  PI  +GF
Sbjct: 118 KKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGD-GVTHTVPIY-EGF 174



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 29/40 (72%), Positives = 36/40 (90%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 231
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLL 51


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  125 bits (302), Expect = 4e-29
 Identities = 63/85 (74%), Positives = 64/85 (75%)
 Frame = +3

Query: 339 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSR 518
           MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQA   
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLS 107

Query: 519 CTRPVVPPVSCWTSGDGGLPHPCPI 593
                        SGD G+ H  PI
Sbjct: 108 LYASGRTTGIVLDSGD-GVSHTVPI 131



 Score =  105 bits (251), Expect = 6e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 237
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  116 bits (280), Expect = 2e-26
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 31/36 (86%), Positives = 32/36 (88%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDME 344
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDME
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDME 84


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  112 bits (270), Expect = 3e-25
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           + VG +A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPL
Sbjct: 56  IFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NREK  +  FE  N PA++V++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGD 55


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  112 bits (270), Expect = 3e-25
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           + VG +A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPL
Sbjct: 56  IFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NREK  +  FE  N PA++V++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGD 55


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  112 bits (270), Expect = 3e-25
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           + VG +A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPL
Sbjct: 56  IFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NREK  +  FE  N PA++V++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGD 55


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score =  101 bits (243), Expect = 6e-22
 Identities = 50/123 (40%), Positives = 72/123 (58%), Gaps = 1/123 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPV 404
           G    + L+VGDEA   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +
Sbjct: 49  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKI 108

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREKM ++MFE +   + Y+AIQA        +       SGD G+ H 
Sbjct: 109 LLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAAWTLYAQGLISGVVIDSGD-GVTHI 167

Query: 585 CPI 593
           CP+
Sbjct: 168 CPV 170



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV 225
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAV 45


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score =  101 bits (242), Expect = 8e-22
 Identities = 50/123 (40%), Positives = 72/123 (58%), Gaps = 1/123 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPV 404
           G    + L+VGDEA   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +
Sbjct: 48  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKI 107

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREKM ++MFE +   + Y+AIQA        +       SGD G+ H 
Sbjct: 108 LLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGD-GVTHI 166

Query: 585 CPI 593
           CP+
Sbjct: 167 CPV 169



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV 225
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAV 44


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score =  101 bits (242), Expect = 8e-22
 Identities = 50/123 (40%), Positives = 72/123 (58%), Gaps = 1/123 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPV 404
           G    + L+VGDEA   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +
Sbjct: 48  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKI 107

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREKM ++MFE +   + Y+AIQA        +       SGD G+ H 
Sbjct: 108 LLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGD-GVTHI 166

Query: 585 CPI 593
           CP+
Sbjct: 167 CPV 169



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV 225
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAV 44


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 95.5 bits (227), Expect = 5e-20
 Identities = 42/85 (49%), Positives = 56/85 (65%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  + G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAFDRTGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFETFN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFETFNVPGLYIAVQA 145



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A V+D G+G  K GFAG+  P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 42/85 (49%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA    G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFETFN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFETFNVPGLYIAVQA 145



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A V+D G+G  K GFAG+  P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 42/85 (49%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA    G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFETFN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFETFNVPGLYIAVQA 145



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A V+D G+G  K GFAG+  P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 28/68 (41%), Positives = 45/68 (66%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 486 AMYVAIQA 509
           A ++   A
Sbjct: 153 AFFLVKNA 160



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 28/68 (41%), Positives = 45/68 (66%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 486 AMYVAIQA 509
           A ++   A
Sbjct: 153 AFFLVKNA 160



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 467
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 468 ETFNTPAMYVAIQA 509
           E +  P++   I A
Sbjct: 139 ECYGIPSVSYGIDA 152



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 467
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 468 ETFNTPAMYVAIQA 509
           E +  P++   I A
Sbjct: 139 ECYGIPSVSYGIDA 152



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           VG++    R    L Y +  + G + NW   + +W + F  + +  + E   +++TE  +
Sbjct: 44  VGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQM 103

Query: 426 NPKANREKMTQIMFETFNTPAMY 494
           N ++ +E   +I+FE +    +Y
Sbjct: 104 NFQSIQEATLEILFEEYKVDGVY 126


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           VG++    R    L Y +  + G + NW   + +W + F  + +  + E   +++TE  +
Sbjct: 44  VGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQM 103

Query: 426 NPKANREKMTQIMFETFNTPAMY 494
           N ++ +E   +I+FE +    +Y
Sbjct: 104 NFQSIQEATLEILFEEYKVDGVY 126


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           VG++    R    L Y +  + G + NW   + +W + F  + +  + E   +++TE  +
Sbjct: 44  VGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQM 103

Query: 426 NPKANREKMTQIMFETFNTPAMY 494
           N ++ +E   +I+FE +    +Y
Sbjct: 104 NFQSIQEATLEILFEEYKVDGVY 126


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.54
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGS 138
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>BT003217-1|AAO24972.1|  824|Drosophila melanogaster RE10170p
           protein.
          Length = 824

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +3

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGD 566
           P   PV  T  P    + R++   + FE+   P  Y A Q   + T   +PP S   +G+
Sbjct: 54  PPSLPVW-TPQPSPVLSGRKEFRPVRFESPTLPRRYTAQQ--QQKTTTTIPPWSSAENGE 110

Query: 567 GGLPHPCP 590
           GG P   P
Sbjct: 111 GGPPPTAP 118


>AE013599-1060|AAF58815.2|  811|Drosophila melanogaster CG18408-PF,
           isoform F protein.
          Length = 811

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +3

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGD 566
           P   PV  T  P    + R++   + FE+   P  Y A Q   + T   +PP S   +G+
Sbjct: 41  PPSLPVW-TPQPSPVLSGRKEFRPVRFESPTLPRRYTAQQ--QQKTTTTIPPWSSAENGE 97

Query: 567 GGLPHPCP 590
           GG P   P
Sbjct: 98  GGPPPTAP 105


>AE013599-1059|AAM68778.1|  824|Drosophila melanogaster CG18408-PC,
           isoform C protein.
          Length = 824

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +3

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGD 566
           P   PV  T  P    + R++   + FE+   P  Y A Q   + T   +PP S   +G+
Sbjct: 54  PPSLPVW-TPQPSPVLSGRKEFRPVRFESPTLPRRYTAQQ--QQKTTTTIPPWSSAENGE 110

Query: 567 GGLPHPCP 590
           GG P   P
Sbjct: 111 GGPPPTAP 118


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189 PLDRGKAPPSGRDGRYGTEGL 251
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 189  PLDRGKAPPSGRDGRYGTEGL 251
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AY089305-1|AAL90043.1|  453|Drosophila melanogaster AT10573p
           protein.
          Length = 453

 Score = 26.2 bits (55), Expect(2) = 4.7
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
 Frame = +3

Query: 510 CSRCTRPVVPPVSCWTS-GDGGL 575
           C RC  PV PP    T+ GDGG+
Sbjct: 231 CYRCIFPVPPPPEAVTNCGDGGV 253



 Score = 21.4 bits (43), Expect(2) = 4.7
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 471 TFNTPAMYVAIQACSRCTRPVV 536
           T N P  Y+   AC   ++P+V
Sbjct: 189 TDNVPTRYLLSDACVMLSKPLV 210


>AE014134-1535|AAF52691.1|  453|Drosophila melanogaster CG13090-PA
           protein.
          Length = 453

 Score = 26.2 bits (55), Expect(2) = 4.7
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
 Frame = +3

Query: 510 CSRCTRPVVPPVSCWTS-GDGGL 575
           C RC  PV PP    T+ GDGG+
Sbjct: 231 CYRCIFPVPPPPEAVTNCGDGGV 253



 Score = 21.4 bits (43), Expect(2) = 4.7
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 471 TFNTPAMYVAIQACSRCTRPVV 536
           T N P  Y+   AC   ++P+V
Sbjct: 189 TDNVPTRYLLSDACVMLSKPLV 210


>AY089302-1|AAL90040.1|  349|Drosophila melanogaster AT10149p
           protein.
          Length = 349

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -1

Query: 280 LLLCASSPTKSPSVPYRPSRPDG 212
           LL+   SPTKSP+ P+   + DG
Sbjct: 301 LLIAKKSPTKSPAAPFDAGKKDG 323


>AE014298-3172|AAF50954.1|  395|Drosophila melanogaster CG14620-PA
           protein.
          Length = 395

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -1

Query: 280 LLLCASSPTKSPSVPYRPSRPDG 212
           LL+   SPTKSP+ P+   + DG
Sbjct: 347 LLIAKKSPTKSPAAPFDAGKKDG 369


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVD 129
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVD 129
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p
           protein.
          Length = 1378

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 305 NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 335


>BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p
           protein.
          Length = 1196

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 123 NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 153


>BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p
           protein.
          Length = 1255

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 71  NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 101


>BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p
           protein.
          Length = 1373

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 189 NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 219


>BT010216-1|AAQ23534.1|  366|Drosophila melanogaster RH40749p
           protein.
          Length = 366

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +2

Query: 383 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSVL 514
           RP+  P P     PQPQ  Q E + +  R +Q+A   +  P  L
Sbjct: 161 RPQPRPQPRPQPQPQPQYVQYEVEEESPRRVQYAPAPQPQPQPL 204


>AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH07910
           protein.
          Length = 1266

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 82  NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 112


>AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD,
           isoform D protein.
          Length = 1254

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 70  NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 100


>AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC,
           isoform C protein.
          Length = 1254

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLY 523
           +PQ Q QQ++    H    QH +H+ +HP  L L+
Sbjct: 70  NPQQQAQQQQQILPH----QHLQHLHKHPHQLQLH 100


>AE014297-4062|AAF56660.2|  366|Drosophila melanogaster CG6131-PA
           protein.
          Length = 366

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +2

Query: 383 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSVL 514
           RP+  P P     PQPQ  Q E + +  R +Q+A   +  P  L
Sbjct: 161 RPQPRPQPRPQPQPQPQYVQYEVEEESPRRVQYAPAPQPQPQPL 204


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,147,782
Number of Sequences: 53049
Number of extensions: 812050
Number of successful extensions: 3230
Number of sequences better than 10.0: 73
Number of HSP's better than 10.0 without gapping: 2779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3177
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2517878700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).