SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M26400-1|AAA28907.1| 2415|Drosophila melanogaster protein ( D.me...   120   2e-27
BT023889-1|ABA81823.1| 1557|Drosophila melanogaster RE03775p pro...   120   2e-27
AE014296-357|AAF47569.1| 2415|Drosophila melanogaster CG1977-PA ...   120   2e-27
AY069741-1|AAL39886.1|  856|Drosophila melanogaster LP06350p pro...    80   3e-15
U07629-1|AAA21249.2| 1494|Drosophila melanogaster beta-heavy-spe...    78   8e-15
AY119626-1|AAM50280.1| 1025|Drosophila melanogaster LP04011p pro...    78   8e-15
AE014296-651|AAF47766.1| 4097|Drosophila melanogaster CG12008-PA...    78   8e-15
AE014296-650|AAS64958.1| 4118|Drosophila melanogaster CG12008-PB...    78   8e-15
AE014296-649|AAS64957.1| 4207|Drosophila melanogaster CG12008-PC...    78   8e-15
S67762-1|AAB29441.2|  150|Drosophila melanogaster alpha-spectrin...    66   3e-11
X53992-1|CAA37939.1| 1645|Drosophila melanogaster betaH spectrin...    60   3e-09
M92288-1|AAA28399.1| 2291|Drosophila melanogaster beta-spectrin ...    55   9e-08
AE014298-2596|AAF48751.1| 2291|Drosophila melanogaster CG5870-PA...    55   9e-08
AF022656-1|AAB87867.1|  971|Drosophila melanogaster beta-H spect...    50   2e-06
BT011160-1|AAR82828.1| 1410|Drosophila melanogaster AT24411p pro...    48   1e-05
AY069615-1|AAL39760.1|  895|Drosophila melanogaster LD37956p pro...    36   0.032
AL031765-2|CAA21121.1|  924|Drosophila melanogaster EG:133E12.1,...    36   0.032
AL031765-1|CAA21120.1|  895|Drosophila melanogaster EG:133E12.1,...    36   0.032
AL009192-4|CAA15688.1|  895|Drosophila melanogaster EG:133E12.1,...    36   0.032
AL009192-3|CAA15689.1|  924|Drosophila melanogaster EG:133E12.1,...    36   0.032
AE014298-311|AAF45705.2|  917|Drosophila melanogaster CG4376-PC,...    36   0.032
AE014298-310|AAF45706.2|  895|Drosophila melanogaster CG4376-PB,...    36   0.032
AE014298-309|AAN09068.1|  895|Drosophila melanogaster CG4376-PA,...    36   0.032
AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB...    35   0.074
AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-P...    35   0.074
AF216663-1|AAF32293.1| 2263|Drosophila melanogaster guanine-nucl...    33   0.30 
AF215635-1|AAF25952.1| 2263|Drosophila melanogaster Rho family g...    33   0.30 
AE014296-165|AAN11455.1| 2263|Drosophila melanogaster CG18214-PC...    33   0.30 
AE014296-164|AAF47436.3| 2263|Drosophila melanogaster CG18214-PA...    33   0.30 
AB035419-1|BAA96093.1| 2263|Drosophila melanogaster Trio protein.      33   0.30 
Y09430-1|CAA70581.1| 4151|Drosophila melanogaster Kakapo protein.      31   0.91 
AY122181-1|AAM52693.1| 1140|Drosophila melanogaster LD39385p pro...    31   0.91 
AF200425-1|AAF24343.1| 5201|Drosophila melanogaster Short stop/K...    31   0.91 
AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-P...    31   0.91 
AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-P...    31   0.91 
AE013599-1790|AAF58319.3| 5501|Drosophila melanogaster CG18076-P...    31   0.91 
AE013599-1789|AAM68561.1| 5201|Drosophila melanogaster CG18076-P...    31   0.91 
AE013599-1788|AAG22268.2| 5390|Drosophila melanogaster CG18076-P...    31   0.91 
AE013599-1787|AAF58317.1| 5385|Drosophila melanogaster CG18076-P...    31   0.91 
X51753-1|CAA36042.1|  895|Drosophila melanogaster protein ( Dros...    31   1.2  
BT030453-1|ABP87895.1|  980|Drosophila melanogaster IP18281p pro...    28   8.5  
AY051730-1|AAK93154.1|  550|Drosophila melanogaster LD25919p pro...    28   8.5  
AF427496-1|AAL25120.1|  734|Drosophila melanogaster occludin-lik...    28   8.5  
AF203342-1|AAF13280.1| 1729|Drosophila melanogaster pericardine ...    28   8.5  
AF186472-1|AAF01416.1| 1409|Drosophila melanogaster condensin su...    28   8.5  
AF185287-1|AAF13306.1| 1409|Drosophila melanogaster XCAP-C/SMC4 ...    28   8.5  
AF160943-1|AAD46883.2| 1012|Drosophila melanogaster LD20207p pro...    28   8.5  
AE014297-1515|AAF54807.1| 2016|Drosophila melanogaster CG6525-PA...    28   8.5  
AE014296-2068|AAF49980.2| 1713|Drosophila melanogaster CG5700-PB...    28   8.5  
AE014134-2761|AAF53560.1| 1409|Drosophila melanogaster CG11397-P...    28   8.5  
AE014134-2707|AAN10938.1| 2282|Drosophila melanogaster CG31817-P...    28   8.5  

>M26400-1|AAA28907.1| 2415|Drosophila melanogaster protein (
           D.melanogaster alpha-spectrin mRNA, complete cds. ).
          Length = 2415

 Score =  120 bits (288), Expect = 2e-27
 Identities = 54/69 (78%), Positives = 63/69 (91%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL EA QQQQ+NR +EDIELWLSE+EGQLLSED+GKDLTSVQNLQKKHALLEADV +
Sbjct: 673 KGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMA 732

Query: 69  HAERIDAIR 43
           H +RI++I+
Sbjct: 733 HQDRIESIK 741



 Score =  112 bits (269), Expect = 4e-25
 Identities = 62/121 (51%), Positives = 83/121 (68%)
 Frame = -1

Query: 602 RLLLEKSRTKRPRSPWKDRPTKYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKV 423
           R  L++  +KR R   +D   +YQQFE R     +    E  KFATDDSYLDPTNLNGK+
Sbjct: 558 RAALQEKSSKR-RQLLEDS-NRYQQFE-RDCDETKGWISEKLKFATDDSYLDPTNLNGKM 614

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           QKHQNFE EL ANK R+++IT VG  L+E +H+A  QI++R++E+  +WE LVQ+S  + 
Sbjct: 615 QKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKG 674

Query: 242 T 240
           T
Sbjct: 675 T 675



 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 37/65 (56%), Positives = 48/65 (73%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +Q+ Y  AV+D++ WL EVE  L +ED GKDL SVQNL KKH L+EAD+ +
Sbjct: 1598 KSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVA 1657

Query: 69   HAERI 55
            H +RI
Sbjct: 1658 HEDRI 1662



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L EA    Q+ R + D E W+ E +  + S+DYG+DLT VQNL+KKH  LEA++ SH  
Sbjct: 1707 RLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEP 1766

Query: 60   RIDAIREPG 34
             I A++E G
Sbjct: 1767 AIQAVQEAG 1775



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 28/69 (40%), Positives = 44/69 (63%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+++SY DPTNL  K+QKHQ FE E+ A+   +  +   G+ ++  +HFA   I  R++E
Sbjct: 70  ASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDE 129

Query: 290 LGGIWERLV 264
           L  +WE L+
Sbjct: 130 LHKLWELLL 138



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL E+   QQ+   VE+ E W++E +  L  EDYG  + +VQ L KKH   E D ++
Sbjct: 1810 RGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTA 1869

Query: 69   HAERIDAIREPG 34
            H +R   I + G
Sbjct: 1870 HKDRCSLICDQG 1881



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 2/120 (1%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF--AQPQ 312
            E  + AT++SY DP N+  K QKHQ FE EL AN  R+  + A+G  L++ +    ++  
Sbjct: 1517 EKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDA 1576

Query: 311  ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGR 132
            +  R+ ++   WE L   ++ +    ++     +     + L+F   +++   +   +G+
Sbjct: 1577 VQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGK 1636



 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 24/69 (34%), Positives = 45/69 (65%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL  A + Q++NR  ++   W++E +  L S+DYG+DL SVQ LQ+KH  +E D++
Sbjct: 249 VRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLA 308

Query: 72  SHAERIDAI 46
           +  +++  +
Sbjct: 309 ALEDKVSTL 317



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/70 (34%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L  A + Q+++R +++ + W++E    L ++D GKDL SVQ LQ+KH  +E D+++
Sbjct: 1173 KASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAA 1232

Query: 69   HAERIDAIRE 40
              ++I  + E
Sbjct: 1233 LRDKIRQLDE 1242



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/81 (33%), Positives = 40/81 (49%)
 Frame = -3

Query: 297  GRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV 118
            G       A  A    +   L ++ Q QQ  R +ED   W+ E E    S + G+DL  V
Sbjct: 763  GNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGV 822

Query: 117  QNLQKKHALLEADVSSHAERI 55
            QNL KKH  + A++++H  R+
Sbjct: 823  QNLIKKHQAVLAEINNHEARL 843



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 23/72 (31%), Positives = 47/72 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L +    QQ++R  ++IE W++E + QL +E+  KD  ++Q+  +KH   EA++++
Sbjct: 1491 KRSRLGDEQTLQQFSRDADEIENWIAE-KLQLATEESYKDPANIQSKHQKHQAFEAELAA 1549

Query: 69   HAERIDAIREPG 34
            +A+RI ++   G
Sbjct: 1550 NADRIQSVLAMG 1561



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/70 (30%), Positives = 41/70 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KLQ+A    Q+ R  E++  W+ + E  + ++++G+DL  V+ LQ+K    + D++S
Sbjct: 144 KGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMAS 203

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 204 QEYRVTEVNQ 213



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++ Q  QY     + E W+ E E      DYGKD  S + L KKH  L +D+ +    
Sbjct: 889  LDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNT 948

Query: 57   IDAIREPGR 31
            I A++E  +
Sbjct: 949  IQALQEQAK 957



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+++ + Q + R  +++E W+ E + Q  SE+  +D T++Q   +KH   EA+VS+
Sbjct: 39  KREKLEDSRRFQYFKRDADELESWIHE-KLQAASEESYRDPTNLQAKIQKHQAFEAEVSA 97

Query: 69  HAERIDAIREPGR 31
           H+  I ++   G+
Sbjct: 98  HSNAIVSLDNTGQ 110



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +DD   D T +    +KH+  E EL +++P +  +   G++L+++ +   P+I  R++ L
Sbjct: 1737 SDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKAL 1796

Query: 287  GGIWERL 267
               W  L
Sbjct: 1797 NQAWAEL 1803



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           ++    Q + R  E  + W+++ E  L +ED G  L SV+ L KKH   E  +++  E+I
Sbjct: 467 EQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKI 526

Query: 54  DAI 46
            A+
Sbjct: 527 KAL 529



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +D+   D T     +++HQ    E+ A           G  LL+  H+A P+I  ++E+L
Sbjct: 1312 SDELANDVTGAEALIERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDL 1371

Query: 287  GGIWERLVQSSS*RETSCRKRLN 219
                E L ++ + R     + L+
Sbjct: 1372 AKAREDLEKAWTERRLQLEQNLD 1394



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = -1

Query: 473 FATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           F T D +  D  ++    +K   F++++ + + RV E+  +  +L++  H  +  I+ R 
Sbjct: 174 FVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRK 233

Query: 296 EELGGIWERLVQ 261
           EEL   W+RL Q
Sbjct: 234 EELNEAWQRLKQ 245



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L  +A  Q   +A + +E W+ + E  + S+++G+DL++VQ L  K    +A +++
Sbjct: 1917 KGALLDNSAYLQFMWKA-DVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNA 1975



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 18/76 (23%), Positives = 36/76 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++DD   D  ++    +KH+  E++L A + +V  + A  +RL  +      QI  +  E
Sbjct: 282 SSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAE 341

Query: 290 LGGIWERLVQSSS*RE 243
           +   W+ L   +  R+
Sbjct: 342 IANYWQSLTTKARERK 357



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           + D+   D       +++HQ  + E+ A +      T  G++LLE EH+A  +I  ++  
Sbjct: 388 SADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAA 447

Query: 290 L 288
           L
Sbjct: 448 L 448



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 15/74 (20%), Positives = 39/74 (52%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD   D  ++    +KH+  E++L A + ++ ++     RL++       Q  ++ +E+ 
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 284  GIWERLVQSSS*RE 243
             +W++++  S+ R+
Sbjct: 1267 EMWDQIITKSTARK 1280



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 22/92 (23%), Positives = 45/92 (48%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            LG+ ES    T+DS  D  ++   ++KHQ  E ++ A++ R+ ++      L+E   F  
Sbjct: 1622 LGEVES-LLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNRADSLVESGQFDT 1680

Query: 317  PQISSRVEELGGIWERLVQSSS*RETSCRKRL 222
              I  + + +   +ER+   ++ R+    + L
Sbjct: 1681 AGIQEKRQSINERYERICNLAAHRQARLNEAL 1712



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 17/68 (25%), Positives = 39/68 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ + QQ+ R  ++ + W+SE + +  ++D   D T++    +KH   E +++++  R
Sbjct: 572 LEDSNRYQQFERDCDETKGWISE-KLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSR 630

Query: 57  IDAIREPG 34
           I+ I   G
Sbjct: 631 IEDITNVG 638



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++    Q Y R  E  E W+S  E  L ++D      +V+ L KKH   +  ++ H +
Sbjct: 1388 QLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQ 1447

Query: 60   RIDAIR 43
            +I A++
Sbjct: 1448 KIAALQ 1453



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/60 (25%), Positives = 33/60 (55%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++KH++FE+ L A + ++  +     +L++ +H+A   ++ R + L      L + SS R
Sbjct: 509 IKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKR 568



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQL-LSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            NKL E  +     R   D+  W+ + E    +++  G+DL  V+ LQKK      D+ ++
Sbjct: 1067 NKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKAN 1126

Query: 66   AERIDAIRE 40
              R+  + E
Sbjct: 1127 EVRLANMNE 1135



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 15/77 (19%), Positives = 39/77 (50%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            +  RE+   A DD+     N+   ++KH++F++ +  ++ ++  +  V  +L+   H+A 
Sbjct: 1409 MSAREAFLNADDDANAGG-NVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYAS 1467

Query: 317  PQISSRVEELGGIWERL 267
              +  + +++   W  L
Sbjct: 1468 NLVDEKRKQVLERWRHL 1484



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 15/67 (22%), Positives = 31/67 (46%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D T++    +KH   E ++ A++ R++ I     + +E  HF    I ++   L
Sbjct: 706 SEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNL 765

Query: 287 GGIWERL 267
              +  L
Sbjct: 766 SARYAAL 772



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            +D+   D + +   + K + F+  L A  +  +  ITA+  +L+   H   P I  R  +
Sbjct: 1949 SDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGD 2008

Query: 290  LGGIWERLVQSSS*RE 243
            +   W++L  +S+ R+
Sbjct: 2009 VIARWQKLRDASNTRK 2024



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 13/69 (18%), Positives = 32/69 (46%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ +   + S++   D+T  + L ++H     ++ + A 
Sbjct: 1282 KLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQEHRTEIDARAG 1341

Query: 60   RIDAIREPG 34
               A  + G
Sbjct: 1342 TFGAFEQFG 1350


>BT023889-1|ABA81823.1| 1557|Drosophila melanogaster RE03775p
           protein.
          Length = 1557

 Score =  120 bits (288), Expect = 2e-27
 Identities = 54/69 (78%), Positives = 63/69 (91%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL EA QQQQ+NR +EDIELWLSE+EGQLLSED+GKDLTSVQNLQKKHALLEADV +
Sbjct: 673 KGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMA 732

Query: 69  HAERIDAIR 43
           H +RI++I+
Sbjct: 733 HQDRIESIK 741



 Score =  109 bits (262), Expect = 3e-24
 Identities = 61/121 (50%), Positives = 82/121 (67%)
 Frame = -1

Query: 602 RLLLEKSRTKRPRSPWKDRPTKYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKV 423
           R  L++  +KR R   +D   +YQQFE R     +    E  KFATDDSYLDPTNLNGK+
Sbjct: 558 RAALQEKSSKR-RQLLEDS-NRYQQFE-RDCDETKGWISEKLKFATDDSYLDPTNLNGKM 614

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           QKHQNFE EL ANK R+++IT VG  L+E +H+A   I++R++E+  +WE LVQ+S  + 
Sbjct: 615 QKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADLINTRMQEIVVLWETLVQASDKKG 674

Query: 242 T 240
           T
Sbjct: 675 T 675



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 28/69 (40%), Positives = 44/69 (63%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+++SY DPTNL  K+QKHQ FE E+ A+   +  +   G+ ++  +HFA   I  R++E
Sbjct: 70  ASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDE 129

Query: 290 LGGIWERLV 264
           L  +WE L+
Sbjct: 130 LHKLWELLL 138



 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 24/69 (34%), Positives = 45/69 (65%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL  A + Q++NR  ++   W++E +  L S+DYG+DL SVQ LQ+KH  +E D++
Sbjct: 249 VRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLA 308

Query: 72  SHAERIDAI 46
           +  +++  +
Sbjct: 309 ALEDKVSTL 317



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/70 (34%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L  A + Q+++R +++ + W++E    L ++D GKDL SVQ LQ+KH  +E D+++
Sbjct: 1173 KASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAA 1232

Query: 69   HAERIDAIRE 40
              ++I  + E
Sbjct: 1233 LRDKIRQLDE 1242



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/81 (33%), Positives = 40/81 (49%)
 Frame = -3

Query: 297  GRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV 118
            G       A  A    +   L ++ Q QQ  R +ED   W+ E E    S + G+DL  V
Sbjct: 763  GNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGV 822

Query: 117  QNLQKKHALLEADVSSHAERI 55
            QNL KKH  + A++++H  R+
Sbjct: 823  QNLIKKHQAVLAEINNHEARL 843



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 21/68 (30%), Positives = 40/68 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KLQ+A    Q+ R  E++  W+ + E  + ++++G+DL  V+ LQ+K    + D++S
Sbjct: 144 KGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMAS 203

Query: 69  HAERIDAI 46
              R+  +
Sbjct: 204 QEYRVTEV 211



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++ Q  QY     + E W+ E E      DYGKD  S + L KKH  L +D+ +    
Sbjct: 889  LDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNT 948

Query: 57   IDAIREPGR 31
            I A++E  +
Sbjct: 949  IQALQEQAK 957



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+++ + Q + R  +++E W+ E + Q  SE+  +D T++Q   +KH   EA+VS+
Sbjct: 39  KREKLEDSRRFQYFKRDADELESWIHE-KLQAASEESYRDPTNLQAKIQKHQAFEAEVSA 97

Query: 69  HAERIDAIREPGR 31
           H+  I ++   G+
Sbjct: 98  HSNAIVSLDNTGQ 110



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           ++    Q + R  E  + W+++ E  L +ED G  L SV+ L KKH   E  +++  E+I
Sbjct: 467 EQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKI 526

Query: 54  DAI 46
            A+
Sbjct: 527 KAL 529



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +D+   D T     +++HQ    E+ A           G  LL+  H+A P+I  ++E+L
Sbjct: 1312 SDELANDVTGAEALIERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDL 1371

Query: 287  GGIWERLVQSSS*RETSCRKRLN 219
                E L ++ + R     + L+
Sbjct: 1372 AKAREDLEKAWTERRLQLEQNLD 1394



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/58 (32%), Positives = 37/58 (63%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            K ++L +    QQ++R  ++IE W++E + QL +E+  KD  ++Q+  +KH   EA++
Sbjct: 1491 KRSRLGDEQTLQQFSRDADEIENWIAE-KLQLATEESYKDPANIQSKHQKHQAFEAEL 1547



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQEL 393
            E  + AT++SY DP N+  K QKHQ FE EL
Sbjct: 1517 EKLQLATEESYKDPANIQSKHQKHQAFEAEL 1547



 Score = 36.7 bits (81), Expect = 0.024
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = -1

Query: 473 FATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           F T D +  D  ++    +K   F++++ + + RV E+  +  +L++  H  +  I+ R 
Sbjct: 174 FVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVIQLADKLVQDGHPERDTITKRK 233

Query: 296 EELGGIWERLVQ 261
           EEL   W+RL Q
Sbjct: 234 EELNEAWQRLKQ 245



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 18/76 (23%), Positives = 36/76 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++DD   D  ++    +KH+  E++L A + +V  + A  +RL  +      QI  +  E
Sbjct: 282 SSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRGKQAE 341

Query: 290 LGGIWERLVQSSS*RE 243
           +   W+ L   +  R+
Sbjct: 342 IANYWQSLTTKARERK 357



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           + D+   D       +++HQ  + E+ A +      T  G++LLE EH+A  +I  ++  
Sbjct: 388 SADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAA 447

Query: 290 L 288
           L
Sbjct: 448 L 448



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 15/74 (20%), Positives = 39/74 (52%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD   D  ++    +KH+  E++L A + ++ ++     RL++       Q  ++ +E+ 
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 284  GIWERLVQSSS*RE 243
             +W++++  S+ R+
Sbjct: 1267 EMWDQIITKSTARK 1280



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 17/68 (25%), Positives = 39/68 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ + QQ+ R  ++ + W+SE + +  ++D   D T++    +KH   E +++++  R
Sbjct: 572 LEDSNRYQQFERDCDETKGWISE-KLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSR 630

Query: 57  IDAIREPG 34
           I+ I   G
Sbjct: 631 IEDITNVG 638



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++    Q Y R  E  E W+S  E  L ++D      +V+ L KKH   +  ++ H +
Sbjct: 1388 QLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQ 1447

Query: 60   RIDAIR 43
            +I A++
Sbjct: 1448 KIAALQ 1453



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/60 (25%), Positives = 33/60 (55%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++KH++FE+ L A + ++  +     +L++ +H+A   ++ R + L      L + SS R
Sbjct: 509 IKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKR 568



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQL-LSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            NKL E  +     R   D+  W+ + E    +++  G+DL  V+ LQKK      D+ ++
Sbjct: 1067 NKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKAN 1126

Query: 66   AERIDAIRE 40
              R+  + E
Sbjct: 1127 EVRLANMNE 1135



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 15/77 (19%), Positives = 39/77 (50%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            +  RE+   A DD+     N+   ++KH++F++ +  ++ ++  +  V  +L+   H+A 
Sbjct: 1409 MSAREAFLNADDDANAGG-NVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYAS 1467

Query: 317  PQISSRVEELGGIWERL 267
              +  + +++   W  L
Sbjct: 1468 NLVDEKRKQVLERWRHL 1484



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 15/67 (22%), Positives = 31/67 (46%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D T++    +KH   E ++ A++ R++ I     + +E  HF    I ++   L
Sbjct: 706 SEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNL 765

Query: 287 GGIWERL 267
              +  L
Sbjct: 766 SARYAAL 772



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 13/69 (18%), Positives = 32/69 (46%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ +   + S++   D+T  + L ++H     ++ + A 
Sbjct: 1282 KLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQEHRTEIDARAG 1341

Query: 60   RIDAIREPG 34
               A  + G
Sbjct: 1342 TFGAFEQFG 1350


>AE014296-357|AAF47569.1| 2415|Drosophila melanogaster CG1977-PA
           protein.
          Length = 2415

 Score =  120 bits (288), Expect = 2e-27
 Identities = 54/69 (78%), Positives = 63/69 (91%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL EA QQQQ+NR +EDIELWLSE+EGQLLSED+GKDLTSVQNLQKKHALLEADV +
Sbjct: 673 KGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMA 732

Query: 69  HAERIDAIR 43
           H +RI++I+
Sbjct: 733 HQDRIESIK 741



 Score =  112 bits (269), Expect = 4e-25
 Identities = 62/121 (51%), Positives = 83/121 (68%)
 Frame = -1

Query: 602 RLLLEKSRTKRPRSPWKDRPTKYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKV 423
           R  L++  +KR R   +D   +YQQFE R     +    E  KFATDDSYLDPTNLNGK+
Sbjct: 558 RAALQEKSSKR-RQLLEDS-NRYQQFE-RDCDETKGWISEKLKFATDDSYLDPTNLNGKM 614

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           QKHQNFE EL ANK R+++IT VG  L+E +H+A  QI++R++E+  +WE LVQ+S  + 
Sbjct: 615 QKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKG 674

Query: 242 T 240
           T
Sbjct: 675 T 675



 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 37/65 (56%), Positives = 48/65 (73%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +Q+ Y  AV+D++ WL EVE  L +ED GKDL SVQNL KKH L+EAD+ +
Sbjct: 1598 KSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVA 1657

Query: 69   HAERI 55
            H +RI
Sbjct: 1658 HEDRI 1662



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L EA    Q+ R + D E W+ E +  + S+DYG+DLT VQNL+KKH  LEA++ SH  
Sbjct: 1707 RLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEP 1766

Query: 60   RIDAIREPG 34
             I A++E G
Sbjct: 1767 AIQAVQEAG 1775



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 28/69 (40%), Positives = 44/69 (63%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+++SY DPTNL  K+QKHQ FE E+ A+   +  +   G+ ++  +HFA   I  R++E
Sbjct: 70  ASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDE 129

Query: 290 LGGIWERLV 264
           L  +WE L+
Sbjct: 130 LHKLWELLL 138



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL E+   QQ+   VE+ E W++E +  L  EDYG  + +VQ L KKH   E D ++
Sbjct: 1810 RGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTA 1869

Query: 69   HAERIDAIREPG 34
            H +R   I + G
Sbjct: 1870 HKDRCSLICDQG 1881



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 2/120 (1%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF--AQPQ 312
            E  + AT++SY DP N+  K QKHQ FE EL AN  R+  + A+G  L++ +    ++  
Sbjct: 1517 EKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDA 1576

Query: 311  ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGR 132
            +  R+ ++   WE L   ++ +    ++     +     + L+F   +++   +   +G+
Sbjct: 1577 VQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGK 1636



 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 24/69 (34%), Positives = 45/69 (65%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL  A + Q++NR  ++   W++E +  L S+DYG+DL SVQ LQ+KH  +E D++
Sbjct: 249 VRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLA 308

Query: 72  SHAERIDAI 46
           +  +++  +
Sbjct: 309 ALEDKVSTL 317



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/70 (34%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L  A + Q+++R +++ + W++E    L ++D GKDL SVQ LQ+KH  +E D+++
Sbjct: 1173 KASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAA 1232

Query: 69   HAERIDAIRE 40
              ++I  + E
Sbjct: 1233 LRDKIRQLDE 1242



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/81 (33%), Positives = 40/81 (49%)
 Frame = -3

Query: 297  GRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV 118
            G       A  A    +   L ++ Q QQ  R +ED   W+ E E    S + G+DL  V
Sbjct: 763  GNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGV 822

Query: 117  QNLQKKHALLEADVSSHAERI 55
            QNL KKH  + A++++H  R+
Sbjct: 823  QNLIKKHQAVLAEINNHEARL 843



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 23/72 (31%), Positives = 47/72 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L +    QQ++R  ++IE W++E + QL +E+  KD  ++Q+  +KH   EA++++
Sbjct: 1491 KRSRLGDEQTLQQFSRDADEIENWIAE-KLQLATEESYKDPANIQSKHQKHQAFEAELAA 1549

Query: 69   HAERIDAIREPG 34
            +A+RI ++   G
Sbjct: 1550 NADRIQSVLAMG 1561



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/70 (30%), Positives = 41/70 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KLQ+A    Q+ R  E++  W+ + E  + ++++G+DL  V+ LQ+K    + D++S
Sbjct: 144 KGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMAS 203

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 204 QEYRVTEVNQ 213



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++ Q  QY     + E W+ E E      DYGKD  S + L KKH  L +D+ +    
Sbjct: 889  LDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNT 948

Query: 57   IDAIREPGR 31
            I A++E  +
Sbjct: 949  IQALQEQAK 957



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+++ + Q + R  +++E W+ E + Q  SE+  +D T++Q   +KH   EA+VS+
Sbjct: 39  KREKLEDSRRFQYFKRDADELESWIHE-KLQAASEESYRDPTNLQAKIQKHQAFEAEVSA 97

Query: 69  HAERIDAIREPGR 31
           H+  I ++   G+
Sbjct: 98  HSNAIVSLDNTGQ 110



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +DD   D T +    +KH+  E EL +++P +  +   G++L+++ +   P+I  R++ L
Sbjct: 1737 SDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKAL 1796

Query: 287  GGIWERL 267
               W  L
Sbjct: 1797 NQAWAEL 1803



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           ++    Q + R  E  + W+++ E  L +ED G  L SV+ L KKH   E  +++  E+I
Sbjct: 467 EQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKI 526

Query: 54  DAI 46
            A+
Sbjct: 527 KAL 529



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +D+   D T     +++HQ    E+ A           G  LL+  H+A P+I  ++E+L
Sbjct: 1312 SDELANDVTGAEALIERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDL 1371

Query: 287  GGIWERLVQSSS*RETSCRKRLN 219
                E L ++ + R     + L+
Sbjct: 1372 AKAREDLEKAWTERRLQLEQNLD 1394



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = -1

Query: 473 FATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           F T D +  D  ++    +K   F++++ + + RV E+  +  +L++  H  +  I+ R 
Sbjct: 174 FVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRK 233

Query: 296 EELGGIWERLVQ 261
           EEL   W+RL Q
Sbjct: 234 EELNEAWQRLKQ 245



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L  +A  Q   +A + +E W+ + E  + S+++G+DL++VQ L  K    +A +++
Sbjct: 1917 KGALLDNSAYLQFMWKA-DVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNA 1975



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/92 (23%), Positives = 45/92 (48%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            LG+ ES    T+DS  D  ++   ++KHQ  E ++ A++ R+ ++      L+E   F  
Sbjct: 1622 LGEVES-LLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDT 1680

Query: 317  PQISSRVEELGGIWERLVQSSS*RETSCRKRL 222
              I  + + +   +ER+   ++ R+    + L
Sbjct: 1681 AGIQEKRQSINERYERICNLAAHRQARLNEAL 1712



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 18/76 (23%), Positives = 36/76 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++DD   D  ++    +KH+  E++L A + +V  + A  +RL  +      QI  +  E
Sbjct: 282 SSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAE 341

Query: 290 LGGIWERLVQSSS*RE 243
           +   W+ L   +  R+
Sbjct: 342 IANYWQSLTTKARERK 357



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           + D+   D       +++HQ  + E+ A +      T  G++LLE EH+A  +I  ++  
Sbjct: 388 SADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAA 447

Query: 290 L 288
           L
Sbjct: 448 L 448



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 15/74 (20%), Positives = 39/74 (52%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD   D  ++    +KH+  E++L A + ++ ++     RL++       Q  ++ +E+ 
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 284  GIWERLVQSSS*RE 243
             +W++++  S+ R+
Sbjct: 1267 EMWDQIITKSTARK 1280



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 17/68 (25%), Positives = 39/68 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ + QQ+ R  ++ + W+SE + +  ++D   D T++    +KH   E +++++  R
Sbjct: 572 LEDSNRYQQFERDCDETKGWISE-KLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSR 630

Query: 57  IDAIREPG 34
           I+ I   G
Sbjct: 631 IEDITNVG 638



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++    Q Y R  E  E W+S  E  L ++D      +V+ L KKH   +  ++ H +
Sbjct: 1388 QLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQ 1447

Query: 60   RIDAIR 43
            +I A++
Sbjct: 1448 KIAALQ 1453



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/60 (25%), Positives = 33/60 (55%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++KH++FE+ L A + ++  +     +L++ +H+A   ++ R + L      L + SS R
Sbjct: 509 IKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKR 568



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQL-LSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            NKL E  +     R   D+  W+ + E    +++  G+DL  V+ LQKK      D+ ++
Sbjct: 1067 NKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKAN 1126

Query: 66   AERIDAIRE 40
              R+  + E
Sbjct: 1127 EVRLANMNE 1135



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 15/77 (19%), Positives = 39/77 (50%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            +  RE+   A DD+     N+   ++KH++F++ +  ++ ++  +  V  +L+   H+A 
Sbjct: 1409 MSAREAFLNADDDANAGG-NVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYAS 1467

Query: 317  PQISSRVEELGGIWERL 267
              +  + +++   W  L
Sbjct: 1468 NLVDEKRKQVLERWRHL 1484



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 15/67 (22%), Positives = 31/67 (46%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D T++    +KH   E ++ A++ R++ I     + +E  HF    I ++   L
Sbjct: 706 SEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNL 765

Query: 287 GGIWERL 267
              +  L
Sbjct: 766 SARYAAL 772



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            +D+   D + +   + K + F+  L A  +  +  ITA+  +L+   H   P I  R  +
Sbjct: 1949 SDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGD 2008

Query: 290  LGGIWERLVQSSS*RE 243
            +   W++L  +S+ R+
Sbjct: 2009 VIARWQKLRDASNTRK 2024



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 13/69 (18%), Positives = 32/69 (46%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ +   + S++   D+T  + L ++H     ++ + A 
Sbjct: 1282 KLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQEHRTEIDARAG 1341

Query: 60   RIDAIREPG 34
               A  + G
Sbjct: 1342 TFGAFEQFG 1350


>AY069741-1|AAL39886.1|  856|Drosophila melanogaster LP06350p
           protein.
          Length = 856

 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 37/65 (56%), Positives = 48/65 (73%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+EA +Q+ Y  AV+D++ WL EVE  L +ED GKDL SVQNL KKH L+EAD+ +
Sbjct: 39  KSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVA 98

Query: 69  HAERI 55
           H +RI
Sbjct: 99  HEDRI 103



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L EA    Q+ R + D E W+ E +  + S+DYG+DLT VQNL+KKH  LEA++ SH  
Sbjct: 148 RLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEP 207

Query: 60  RIDAIREPG 34
            I A++E G
Sbjct: 208 AIQAVQEAG 216



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL E+   QQ+   VE+ E W++E +  L  EDYG  + +VQ L KKH   E D ++
Sbjct: 251 RGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTA 310

Query: 69  HAERIDAIREPG 34
           H +R   I + G
Sbjct: 311 HKDRCSLICDQG 322



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           +DD   D T +    +KH+  E EL +++P +  +   G++L+++ +   P+I  R++ L
Sbjct: 178 SDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKAL 237

Query: 287 GGIWERL 267
              W  L
Sbjct: 238 NQAWAEL 244



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG  L  +A  Q   +A + +E W+ + E  + S+++G+DL++VQ L  K    +A +++
Sbjct: 358 KGALLDNSAYLQFMWKA-DVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNA 416



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/92 (23%), Positives = 45/92 (48%)
 Frame = -1

Query: 497 LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
           LG+ ES    T+DS  D  ++   ++KHQ  E ++ A++ R+ ++      L+E   F  
Sbjct: 63  LGEVES-LLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDT 121

Query: 317 PQISSRVEELGGIWERLVQSSS*RETSCRKRL 222
             I  + + +   +ER+   ++ R+    + L
Sbjct: 122 AGIQEKRQSINERYERICNLAAHRQARLNEAL 153



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +D+   D + +   + K + F+  L A  +  +  ITA+  +L+   H   P I  R  +
Sbjct: 390 SDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGD 449

Query: 290 LGGIWERLVQSSS*RE 243
           +   W++L  +S+ R+
Sbjct: 450 VIARWQKLRDASNTRK 465


>U07629-1|AAA21249.2| 1494|Drosophila melanogaster
           beta-heavy-spectrin protein.
          Length = 1494

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 270 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 329

Query: 75  SSHAERIDAIRE 40
           + H E  D +++
Sbjct: 330 AHHGELADQLKQ 341



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 198 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 257

Query: 290 LGGIWERLVQSS 255
           L G W +L  +S
Sbjct: 258 LEGDWLKLKGAS 269



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 377 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 436

Query: 72  SHAERIDAIREPGR 31
           S    I A+ + G+
Sbjct: 437 SQEPLIQALLQRGQ 450



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 63  RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 120

Query: 69  HAERIDAIRE 40
           HA+ +D +++
Sbjct: 121 HADHVDTLQK 130



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L +KH + E+++     +
Sbjct: 700 LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ 759

Query: 57  IDAI 46
           +D++
Sbjct: 760 VDSV 763



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 487 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 546

Query: 60  RIDAI 46
            I+ +
Sbjct: 547 SIEKV 551



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 165 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 223

Query: 75  SSHAERIDAIREPG 34
            S++ R+ ++   G
Sbjct: 224 LSNSPRVQSVIHEG 237



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 18/70 (25%), Positives = 37/70 (52%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++L E  +  +Y R  E++  W+ +      SEDYG+D+  V+ L        ++++++ 
Sbjct: 592 SRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANE 651

Query: 63  ERIDAIREPG 34
            R++A  E G
Sbjct: 652 ARVEACLERG 661



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + +  E +E W+S  E QL     G  +  V++L ++H   E  V++  E+  AI+
Sbjct: 919  QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIK 976



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 420 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 470


>AY119626-1|AAM50280.1| 1025|Drosophila melanogaster LP04011p
           protein.
          Length = 1025

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 501 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 560

Query: 75  SSHAERIDAIRE 40
           + H E  D +++
Sbjct: 561 AHHGELADQLKQ 572



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 429 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 488

Query: 290 LGGIWERLVQSS 255
           L G W +L  +S
Sbjct: 489 LEGDWLKLKGAS 500



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 608 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 667

Query: 72  SHAERIDAIREPGR 31
           S    I A+ + G+
Sbjct: 668 SQEPLIQALLQRGQ 681



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 294 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 351

Query: 69  HAERIDAIRE 40
           HA+ +D +++
Sbjct: 352 HADHVDTLQK 361



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 718 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 777

Query: 60  RIDAI 46
            I+ +
Sbjct: 778 SIEKV 782



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 396 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 454

Query: 75  SSHAERIDAIREPG 34
            S++ R+ ++   G
Sbjct: 455 LSNSPRVQSVIHEG 468



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333  RTFCSTSNIVSRG-RAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
            R    +SNI  +  + G+       + + + ++L E  +  +Y R  E++  W+ +    
Sbjct: 792  RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAV 851

Query: 156  LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
              SEDYG+D+  V+ L        ++++++  R++A  E G
Sbjct: 852  TASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERG 892



 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNL 109
            L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L
Sbjct: 931  LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQAL 973



 Score = 35.9 bits (79), Expect = 0.042
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 93  FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 145



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 651 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 701


>AE014296-651|AAF47766.1| 4097|Drosophila melanogaster CG12008-PA,
            isoform A protein.
          Length = 4097

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 2873 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 2932

Query: 75   SSHAERIDAIRE 40
            + H E  D +++
Sbjct: 2933 AHHGELADQLKQ 2944



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 2801 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 2860

Query: 290  LGGIWERLVQSS 255
            L G W +L  +S
Sbjct: 2861 LEGDWLKLKGAS 2872



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 38/116 (32%), Positives = 66/116 (56%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D++Y D +NL  K+QKHQ FE+EL+AN+ ++  +T  G+ L++  +   P++ SRV
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRV 1476

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI 129
             +L   W+ L+  S   E   RK    +S    +R+L    +K+ +  SA  +G +
Sbjct: 1477 ADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/74 (33%), Positives = 47/74 (63%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E KG KL++AA Q+++NR++ED +  + E++  L S D G DL S ++L  K  +LE+++
Sbjct: 1491 EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEI 1550

Query: 75   SSHAERIDAIREPG 34
            +   +++  +   G
Sbjct: 1551 TIWDQKVAELVSTG 1564



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 2980 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039

Query: 72   SHAERIDAIREPGR 31
            S    I A+ + G+
Sbjct: 3040 SQEPLIQALLQRGQ 3053



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = -1

Query: 458  SYLDPTNLNGKV---QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            SY + TNL+ K+   QKHQ F+ E+ AN+ R+ EI   G  LL  +H + P+I   +E +
Sbjct: 2271 SYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIV 2330

Query: 287  GGIWERLV 264
               W+ L+
Sbjct: 2331 LEAWQGLL 2338



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 2723

Query: 69   HAERIDAIRE 40
            HA+ +D +++
Sbjct: 2724 HADHVDTLQK 2733



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L +KH + E+++     +
Sbjct: 3303 LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ 3362

Query: 57   IDAI 46
            +D++
Sbjct: 3363 VDSV 3366



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -3

Query: 273 ATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           A  A+ EL+  +L++AA+  Q+     + E WL+E    + S DYG D  S Q L ++H 
Sbjct: 695 ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 93  LLEADVSSHA 64
            L+ ++++++
Sbjct: 755 DLQGELNAYS 764



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E+++ KP+  +++  GKRL+  +H    +I SR++ L   W+ L
Sbjct: 645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQAL 696



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+  + +Y    +++E W+ E E    SEDYG+D   +Q LQ K   L+  V   A+
Sbjct: 1814 RLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGAD 1873

Query: 60   RID 52
            R+D
Sbjct: 1874 RVD 1876



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH- 67
            N+++    QQ +N + + +  W+  V+ QL +++  +D+ +  NL KKH  L  D+ +H 
Sbjct: 1180 NRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD 1239

Query: 66   AERIDAIR 43
             E ++ I+
Sbjct: 1240 TEFVEVIQ 1247



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL  + + QQY     +IE WL E    L S +YG+D  S   L  KH  +E ++ +
Sbjct: 1705 RSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDT 1764

Query: 69   HA 64
            ++
Sbjct: 1765 YS 1766



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  E +G  L+EA    ++N  ++ IE W+ + E  + + D G+DL     L +K   ++
Sbjct: 2339 AELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVD 2398

Query: 84   ADVSSHAERIDAIRE 40
            +D+    +R+  I +
Sbjct: 2399 SDMRVDDQRVKHINQ 2413



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 3090 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 3149

Query: 60   RIDAI 46
             I+ +
Sbjct: 3150 SIEKV 3154



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/70 (27%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+ A+  + +NR  ++ ++W+SE   QL +     DL +VQ LQ++H  LE +++   ++
Sbjct: 1076 LEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDK 1135

Query: 57   IDAIREPGRA 28
            ++ +   G +
Sbjct: 1136 VNRVTYLGNS 1145



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 2768 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 2826

Query: 75   SSHAERIDAIREPG 34
             S++ R+ ++   G
Sbjct: 2827 LSNSPRVQSVIHEG 2840



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333  RTFCSTSNIVSRG-RAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
            R    +SNI  +  + G+       + + + ++L E  +  +Y R  E++  W+ +    
Sbjct: 3164 RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAV 3223

Query: 156  LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
              SEDYG+D+  V+ L        ++++++  R++A  E G
Sbjct: 3224 TASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERG 3264



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 20/78 (25%), Positives = 39/78 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+E+    ++   ++    W++E      S + G++L   Q+L KKH  LEA++  H  
Sbjct: 1602 KLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQP 1661

Query: 60   RIDAIREPGRASS*KREP 7
             I+     G++   ++ P
Sbjct: 1662 MINKALVAGQSLISQQHP 1679



 Score = 35.9 bits (79), Expect = 0.042
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210  YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
            +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 2465 FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + +  E +E W+S  E QL     G  +  V++L ++H   E  V++  E+  AI+
Sbjct: 3522 QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIK 3579



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -1

Query: 488  RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
            RE  + A+ + Y  D  +L     K  + +  ++    RVD+   + K+L++ E     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 311  ISSRVEELGGIWERLVQSSS*RE 243
            +  R E+L   WE L+Q  + RE
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQRE 1918



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 204  RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            R  + I+   S  +  L S D+G+ +  VQN  +KH   E  + +  E++  ++E GR
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGR 2200



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+EA     +    ++ E WL + +    +    KDL +V +LQ+KH  LE ++ S   
Sbjct: 600 RLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP 659

Query: 60  RIDAIREPGRASS*KREPLS 1
           +   +   G+    ++ P S
Sbjct: 660 KSGQMSTAGKRLIGEQHPRS 679



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 3023 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 3073



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            ++  K++KH  FE+ +Q  + +V  +   G++L+E  H+    I +
Sbjct: 2170 DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQT 2215



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = -3

Query: 171 EVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           E++ Q  SED G  L  V+ L + H+L E  V+++ E +
Sbjct: 517 ELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETL 555



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL  A +  +++R V +  L+  + +   LS++ G+DL S   L +KH   E D+ +   
Sbjct: 1920 KLHAAGEIHRFHRDVAEA-LFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 60   RIDAIRE 40
            ++  + E
Sbjct: 1979 QLQVLVE 1985


>AE014296-650|AAS64958.1| 4118|Drosophila melanogaster CG12008-PB,
            isoform B protein.
          Length = 4118

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 2873 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 2932

Query: 75   SSHAERIDAIRE 40
            + H E  D +++
Sbjct: 2933 AHHGELADQLKQ 2944



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 2801 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 2860

Query: 290  LGGIWERLVQSS 255
            L G W +L  +S
Sbjct: 2861 LEGDWLKLKGAS 2872



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 38/116 (32%), Positives = 66/116 (56%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D++Y D +NL  K+QKHQ FE+EL+AN+ ++  +T  G+ L++  +   P++ SRV
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRV 1476

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI 129
             +L   W+ L+  S   E   RK    +S    +R+L    +K+ +  SA  +G +
Sbjct: 1477 ADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/74 (33%), Positives = 47/74 (63%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E KG KL++AA Q+++NR++ED +  + E++  L S D G DL S ++L  K  +LE+++
Sbjct: 1491 EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEI 1550

Query: 75   SSHAERIDAIREPG 34
            +   +++  +   G
Sbjct: 1551 TIWDQKVAELVSTG 1564



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 2980 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039

Query: 72   SHAERIDAIREPGR 31
            S    I A+ + G+
Sbjct: 3040 SQEPLIQALLQRGQ 3053



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = -1

Query: 458  SYLDPTNLNGKV---QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            SY + TNL+ K+   QKHQ F+ E+ AN+ R+ EI   G  LL  +H + P+I   +E +
Sbjct: 2271 SYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIV 2330

Query: 287  GGIWERLV 264
               W+ L+
Sbjct: 2331 LEAWQGLL 2338



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 2723

Query: 69   HAERIDAIRE 40
            HA+ +D +++
Sbjct: 2724 HADHVDTLQK 2733



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L +KH + E+++     +
Sbjct: 3303 LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ 3362

Query: 57   IDAI 46
            +D++
Sbjct: 3363 VDSV 3366



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -3

Query: 273 ATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           A  A+ EL+  +L++AA+  Q+     + E WL+E    + S DYG D  S Q L ++H 
Sbjct: 695 ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 93  LLEADVSSHA 64
            L+ ++++++
Sbjct: 755 DLQGELNAYS 764



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E+++ KP+  +++  GKRL+  +H    +I SR++ L   W+ L
Sbjct: 645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQAL 696



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+  + +Y    +++E W+ E E    SEDYG+D   +Q LQ K   L+  V   A+
Sbjct: 1814 RLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGAD 1873

Query: 60   RID 52
            R+D
Sbjct: 1874 RVD 1876



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH- 67
            N+++    QQ +N + + +  W+  V+ QL +++  +D+ +  NL KKH  L  D+ +H 
Sbjct: 1180 NRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD 1239

Query: 66   AERIDAIR 43
             E ++ I+
Sbjct: 1240 TEFVEVIQ 1247



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL  + + QQY     +IE WL E    L S +YG+D  S   L  KH  +E ++ +
Sbjct: 1705 RSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDT 1764

Query: 69   HA 64
            ++
Sbjct: 1765 YS 1766



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  E +G  L+EA    ++N  ++ IE W+ + E  + + D G+DL     L +K   ++
Sbjct: 2339 AELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVD 2398

Query: 84   ADVSSHAERIDAIRE 40
            +D+    +R+  I +
Sbjct: 2399 SDMRVDDQRVKHINQ 2413



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 3090 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 3149

Query: 60   RIDAI 46
             I+ +
Sbjct: 3150 SIEKV 3154



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/70 (27%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+ A+  + +NR  ++ ++W+SE   QL +     DL +VQ LQ++H  LE +++   ++
Sbjct: 1076 LEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDK 1135

Query: 57   IDAIREPGRA 28
            ++ +   G +
Sbjct: 1136 VNRVTYLGNS 1145



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 2768 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 2826

Query: 75   SSHAERIDAIREPG 34
             S++ R+ ++   G
Sbjct: 2827 LSNSPRVQSVIHEG 2840



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333  RTFCSTSNIVSRG-RAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
            R    +SNI  +  + G+       + + + ++L E  +  +Y R  E++  W+ +    
Sbjct: 3164 RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAV 3223

Query: 156  LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
              SEDYG+D+  V+ L        ++++++  R++A  E G
Sbjct: 3224 TASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERG 3264



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 20/78 (25%), Positives = 39/78 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+E+    ++   ++    W++E      S + G++L   Q+L KKH  LEA++  H  
Sbjct: 1602 KLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQP 1661

Query: 60   RIDAIREPGRASS*KREP 7
             I+     G++   ++ P
Sbjct: 1662 MINKALVAGQSLISQQHP 1679



 Score = 35.9 bits (79), Expect = 0.042
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210  YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
            +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 2465 FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + +  E +E W+S  E QL     G  +  V++L ++H   E  V++  E+  AI+
Sbjct: 3522 QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIK 3579



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -1

Query: 488  RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
            RE  + A+ + Y  D  +L     K  + +  ++    RVD+   + K+L++ E     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 311  ISSRVEELGGIWERLVQSSS*RE 243
            +  R E+L   WE L+Q  + RE
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQRE 1918



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 204  RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            R  + I+   S  +  L S D+G+ +  VQN  +KH   E  + +  E++  ++E GR
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGR 2200



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+EA     +    ++ E WL + +    +    KDL +V +LQ+KH  LE ++ S   
Sbjct: 600 RLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP 659

Query: 60  RIDAIREPGRASS*KREPLS 1
           +   +   G+    ++ P S
Sbjct: 660 KSGQMSTAGKRLIGEQHPRS 679



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 3023 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 3073



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            ++  K++KH  FE+ +Q  + +V  +   G++L+E  H+    I +
Sbjct: 2170 DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQT 2215



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = -3

Query: 171 EVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           E++ Q  SED G  L  V+ L + H+L E  V+++ E +
Sbjct: 517 ELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETL 555



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL  A +  +++R V +  L+  + +   LS++ G+DL S   L +KH   E D+ +   
Sbjct: 1920 KLHAAGEIHRFHRDVAEA-LFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 60   RIDAIRE 40
            ++  + E
Sbjct: 1979 QLQVLVE 1985


>AE014296-649|AAS64957.1| 4207|Drosophila melanogaster CG12008-PC,
            isoform C protein.
          Length = 4207

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 2873 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 2932

Query: 75   SSHAERIDAIRE 40
            + H E  D +++
Sbjct: 2933 AHHGELADQLKQ 2944



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 2801 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 2860

Query: 290  LGGIWERLVQSS 255
            L G W +L  +S
Sbjct: 2861 LEGDWLKLKGAS 2872



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 38/116 (32%), Positives = 66/116 (56%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D++Y D +NL  K+QKHQ FE+EL+AN+ ++  +T  G+ L++  +   P++ SRV
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRV 1476

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI 129
             +L   W+ L+  S   E   RK    +S    +R+L    +K+ +  SA  +G +
Sbjct: 1477 ADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/74 (33%), Positives = 47/74 (63%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E KG KL++AA Q+++NR++ED +  + E++  L S D G DL S ++L  K  +LE+++
Sbjct: 1491 EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEI 1550

Query: 75   SSHAERIDAIREPG 34
            +   +++  +   G
Sbjct: 1551 TIWDQKVAELVSTG 1564



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 2980 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039

Query: 72   SHAERIDAIREPGR 31
            S    I A+ + G+
Sbjct: 3040 SQEPLIQALLQRGQ 3053



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = -1

Query: 458  SYLDPTNLNGKV---QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            SY + TNL+ K+   QKHQ F+ E+ AN+ R+ EI   G  LL  +H + P+I   +E +
Sbjct: 2271 SYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIV 2330

Query: 287  GGIWERLV 264
               W+ L+
Sbjct: 2331 LEAWQGLL 2338



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 2723

Query: 69   HAERIDAIRE 40
            HA+ +D +++
Sbjct: 2724 HADHVDTLQK 2733



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L +KH + E+++     +
Sbjct: 3303 LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ 3362

Query: 57   IDAI 46
            +D++
Sbjct: 3363 VDSV 3366



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -3

Query: 273 ATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           A  A+ EL+  +L++AA+  Q+     + E WL+E    + S DYG D  S Q L ++H 
Sbjct: 695 ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 93  LLEADVSSHA 64
            L+ ++++++
Sbjct: 755 DLQGELNAYS 764



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E+++ KP+  +++  GKRL+  +H    +I SR++ L   W+ L
Sbjct: 645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQAL 696



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+  + +Y    +++E W+ E E    SEDYG+D   +Q LQ K   L+  V   A+
Sbjct: 1814 RLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGAD 1873

Query: 60   RID 52
            R+D
Sbjct: 1874 RVD 1876



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH- 67
            N+++    QQ +N + + +  W+  V+ QL +++  +D+ +  NL KKH  L  D+ +H 
Sbjct: 1180 NRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD 1239

Query: 66   AERIDAIR 43
             E ++ I+
Sbjct: 1240 TEFVEVIQ 1247



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL  + + QQY     +IE WL E    L S +YG+D  S   L  KH  +E ++ +
Sbjct: 1705 RSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDT 1764

Query: 69   HA 64
            ++
Sbjct: 1765 YS 1766



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  E +G  L+EA    ++N  ++ IE W+ + E  + + D G+DL     L +K   ++
Sbjct: 2339 AELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVD 2398

Query: 84   ADVSSHAERIDAIRE 40
            +D+    +R+  I +
Sbjct: 2399 SDMRVDDQRVKHINQ 2413



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 3090 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 3149

Query: 60   RIDAI 46
             I+ +
Sbjct: 3150 SIEKV 3154



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/70 (27%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+ A+  + +NR  ++ ++W+SE   QL +     DL +VQ LQ++H  LE +++   ++
Sbjct: 1076 LEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDK 1135

Query: 57   IDAIREPGRA 28
            ++ +   G +
Sbjct: 1136 VNRVTYLGNS 1145



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 2768 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 2826

Query: 75   SSHAERIDAIREPG 34
             S++ R+ ++   G
Sbjct: 2827 LSNSPRVQSVIHEG 2840



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333  RTFCSTSNIVSRG-RAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
            R    +SNI  +  + G+       + + + ++L E  +  +Y R  E++  W+ +    
Sbjct: 3164 RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAV 3223

Query: 156  LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
              SEDYG+D+  V+ L        ++++++  R++A  E G
Sbjct: 3224 TASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERG 3264



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 20/78 (25%), Positives = 39/78 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+E+    ++   ++    W++E      S + G++L   Q+L KKH  LEA++  H  
Sbjct: 1602 KLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQP 1661

Query: 60   RIDAIREPGRASS*KREP 7
             I+     G++   ++ P
Sbjct: 1662 MINKALVAGQSLISQQHP 1679



 Score = 35.9 bits (79), Expect = 0.042
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210  YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
            +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 2465 FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + +  E +E W+S  E QL     G  +  V++L ++H   E  V++  E+  AI+
Sbjct: 3522 QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIK 3579



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -1

Query: 488  RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
            RE  + A+ + Y  D  +L     K  + +  ++    RVD+   + K+L++ E     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 311  ISSRVEELGGIWERLVQSSS*RE 243
            +  R E+L   WE L+Q  + RE
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQRE 1918



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 204  RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            R  + I+   S  +  L S D+G+ +  VQN  +KH   E  + +  E++  ++E GR
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGR 2200



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+EA     +    ++ E WL + +    +    KDL +V +LQ+KH  LE ++ S   
Sbjct: 600 RLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP 659

Query: 60  RIDAIREPGRASS*KREPLS 1
           +   +   G+    ++ P S
Sbjct: 660 KSGQMSTAGKRLIGEQHPRS 679



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 3023 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 3073



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            ++  K++KH  FE+ +Q  + +V  +   G++L+E  H+    I +
Sbjct: 2170 DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQT 2215



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = -3

Query: 171 EVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           E++ Q  SED G  L  V+ L + H+L E  V+++ E +
Sbjct: 517 ELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETL 555



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL  A +  +++R V +  L+  + +   LS++ G+DL S   L +KH   E D+ +   
Sbjct: 1920 KLHAAGEIHRFHRDVAEA-LFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 60   RIDAIRE 40
            ++  + E
Sbjct: 1979 QLQVLVE 1985


>S67762-1|AAB29441.2|  150|Drosophila melanogaster alpha-spectrin
           protein.
          Length = 150

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 28/69 (40%), Positives = 43/69 (62%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+++SY DPTNL  K+QKHQ FE E+ A+   +  +   G  ++  +HFA   I  R++E
Sbjct: 70  ASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGDEMINQQHFASESIQVRLDE 129

Query: 290 LGGIWERLV 264
           L  +WE L+
Sbjct: 130 LHKLWELLL 138



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 23/72 (31%), Positives = 43/72 (59%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+++ + Q + R  +++E W+ E + Q  SE+  +D T++Q   +KH   EA+VS+
Sbjct: 39  KREKLEDSRRFQYFKRDADELESWIHE-KLQAASEESYRDPTNLQAKIQKHQAFEAEVSA 97

Query: 69  HAERIDAIREPG 34
           H+  I ++   G
Sbjct: 98  HSNAIVSLDNTG 109


>X53992-1|CAA37939.1| 1645|Drosophila melanogaster betaH spectrin
            protein.
          Length = 1645

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 37/116 (31%), Positives = 66/116 (56%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D++Y D +NL  K+QKHQ FE+EL+AN+ ++  +T  G+ L++  +   P++ SRV
Sbjct: 1431 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRV 1489

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI 129
             +L   W+ L+  S   E   RK    +S    +R+L    +K+ +  +A  +G +
Sbjct: 1490 ADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDAALRSGDV 1542



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/74 (33%), Positives = 47/74 (63%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E KG KL++AA Q+++NR++ED +  + E++  L S D G DL S ++L  K  +LE+++
Sbjct: 1504 EDKGRKLEQAASQREHNRSLEDAKKKVDELDAALRSGDVGNDLRSCKDLINKQQILESEI 1563

Query: 75   SSHAERIDAIREPG 34
            +   +++  +   G
Sbjct: 1564 TIWDQKVAELVSTG 1577



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -3

Query: 273 ATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           A  A+ EL+  +L++AA+  Q+     + E WL+E    + S DYG D  S Q L ++H 
Sbjct: 708 ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKMALVNSRDYGNDEPSAQALLQRHR 767

Query: 93  LLEADVSSHA 64
            L+ ++++++
Sbjct: 768 DLQGELNAYS 777



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E+++ KP+  +++  GKRL+  +H    +I SR++ L   W+ L
Sbjct: 658 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQAL 709



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH- 67
            N+++    QQ +N + + +  W+  V+ QL +++  +D+ +  NL KKH  L  D+ +H 
Sbjct: 1193 NRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD 1252

Query: 66   AERIDAIR 43
             E ++ I+
Sbjct: 1253 TEFVEVIQ 1260



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/70 (27%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+ A+  + +NR  ++ ++W+SE   QL +     DL +VQ LQ++H  LE +++   ++
Sbjct: 1089 LEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDK 1148

Query: 57   IDAIREPGRA 28
            ++ +   G +
Sbjct: 1149 VNRVTYLGNS 1158



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+EA     +    ++ E WL + +    +    KDL +V +LQ+KH  LE ++ S   
Sbjct: 613 RLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP 672

Query: 60  RIDAIREPGRASS*KREPLS 1
           +   +   G+    ++ P S
Sbjct: 673 KSGQMSTAGKRLIGEQHPRS 692



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = -3

Query: 171 EVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           E++ Q  SED G  L  V+ L + H+L E  V+++ E +
Sbjct: 530 ELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETL 568


>M92288-1|AAA28399.1| 2291|Drosophila melanogaster beta-spectrin
            protein.
          Length = 2291

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 31/78 (39%), Positives = 41/78 (52%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L E+ + QQY    ++ E W+SE E  ++ ED GKD  S QNL KKH  LE  V
Sbjct: 1583 ENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRGKDEISAQNLMKKHENLEQSV 1642

Query: 75   SSHAERIDAIREPGRASS 22
              +A  I  + E  R  S
Sbjct: 1643 EDYANTIRQLGEVARQFS 1660



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++  +  Q+ R VED +LW+ E      S DYG  L +V  L+KK+  L  ++ +H  R
Sbjct: 1483 LEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPR 1542

Query: 57   IDAIREPGR 31
            I+AI   GR
Sbjct: 1543 INAICNNGR 1551



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 25/86 (29%), Positives = 46/86 (53%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +TD+   D T +N  + KH+  E E+ ++ P++  +  VG  L+   HF   +I  R++E
Sbjct: 659 STDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKE 718

Query: 290 LGGIWERLVQSSS*RETSCRKRLNNS 213
           +   W+ L+  +  R    R+RL N+
Sbjct: 719 ILNKWDHLLDLTKYR----RQRLENA 740



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/69 (30%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D+ 
Sbjct: 411 IRQEKLEQLAAR--FDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIF 468

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 469 AYEERVQAV 477



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 22/65 (33%), Positives = 42/65 (64%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ + Q QQ  + +  I   + E++  L+++DYGK L  V++L +KH+L+EAD++   E
Sbjct: 519 RLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGE 578

Query: 60  RIDAI 46
           R+  +
Sbjct: 579 RVKVV 583



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/70 (28%), Positives = 41/70 (58%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++L+E+ +  Q+     D E W+ E E  + +++ G DLT+V  +  KH  LE++++SH 
Sbjct: 629 SRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHD 688

Query: 63  ERIDAIREPG 34
            ++  + + G
Sbjct: 689 PQLQNVAKVG 698



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 40/67 (59%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ A +  Q     +D++ W+ +    + SED G+D  +VQ+L KKH  +  ++ ++AE
Sbjct: 736 RLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAE 795

Query: 60  RIDAIRE 40
            IDA+ +
Sbjct: 796 VIDALHK 802



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 19/68 (27%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L +A ++    +  +DI+ +++++E Q++S D   DLTSV  L +K  +++  ++ 
Sbjct: 1372 KGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNILMQKQQVIQTQMAV 1431

Query: 69   HAERIDAI 46
             A +++ I
Sbjct: 1432 KARQVEEI 1439



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +   LQ   +  Q+ R     E WL   E  LLS + G  +  V+NL KKH   E  
Sbjct: 2007 WEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKS 2066

Query: 78   VSSHAERIDAI 46
             ++  ER  A+
Sbjct: 2067 AAAQEERFSAL 2077



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 16/72 (22%), Positives = 36/72 (50%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            + +KL+EA    ++ R ++  + WL++ +  + SED    L   + L  +H  +  ++ +
Sbjct: 1051 RDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDN 1110

Query: 69   HAERIDAIREPG 34
            + E    + E G
Sbjct: 1111 YTEDYKNMMEYG 1122



 Score = 36.7 bits (81), Expect = 0.024
 Identities = 15/61 (24%), Positives = 33/61 (54%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD+ ++      ++++H+ F   ++AN  +++ +  V   L+E +HF   +I  R E + 
Sbjct: 1195 DDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENIT 1254

Query: 284  G 282
            G
Sbjct: 1255 G 1255



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -1

Query: 476  KFAT--DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            K+AT  D+SY     ++ K  +HQ FE E+ ANK R+ E     + L + +   +  I  
Sbjct: 1294 KYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEP 1353

Query: 302  RVEEL 288
            +++EL
Sbjct: 1354 KLKEL 1358



 Score = 32.3 bits (70), Expect = 0.52
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++  QQ +NR     E+ LS+ E  L  +D   +L   +N  K+H      + ++ ++
Sbjct: 1165 LSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDK 1224

Query: 57   IDAI 46
            I+ +
Sbjct: 1225 INTL 1228



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            +L EA Q    +R V+D+E W+++ E    S++ G+D   V  L ++
Sbjct: 1694 RLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSER 1740



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/75 (18%), Positives = 37/75 (49%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +L+  +L +A    +     + +E W+ E    L +   GKD+  V+ ++ +    + ++
Sbjct: 836  KLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEM 895

Query: 75   SSHAERIDAIREPGR 31
            +++A R+  + +  R
Sbjct: 896  NANASRVAVVNQLAR 910



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 13/58 (22%), Positives = 32/58 (55%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N++   +K+Q+   E+  ++PR++ I   G++L++  H    +  + + +L   W+ L
Sbjct: 1521 NVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQEL 1578



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/60 (23%), Positives = 26/60 (43%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T +   D + +   +  HQ+ + E+   +       ++GK LL   H+A   I  R+  L
Sbjct: 1937 TSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTL 1996


>AE014298-2596|AAF48751.1| 2291|Drosophila melanogaster CG5870-PA
            protein.
          Length = 2291

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 31/78 (39%), Positives = 41/78 (52%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L E+ + QQY    ++ E W+SE E  ++ ED GKD  S QNL KKH  LE  V
Sbjct: 1583 ENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRGKDEISAQNLMKKHENLEQSV 1642

Query: 75   SSHAERIDAIREPGRASS 22
              +A  I  + E  R  S
Sbjct: 1643 EDYANTIRQLGEVARQFS 1660



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++  +  Q+ R VED +LW+ E      S DYG  L +V  L+KK+  L  ++ +H  R
Sbjct: 1483 LEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPR 1542

Query: 57   IDAIREPGR 31
            I+AI   GR
Sbjct: 1543 INAICNNGR 1551



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 25/86 (29%), Positives = 46/86 (53%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +TD+   D T +N  + KH+  E E+ ++ P++  +  VG  L+   HF   +I  R++E
Sbjct: 659 STDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKE 718

Query: 290 LGGIWERLVQSSS*RETSCRKRLNNS 213
           +   W+ L+  +  R    R+RL N+
Sbjct: 719 ILNKWDHLLDLTKYR----RQRLENA 740



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/69 (30%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D+ 
Sbjct: 411 IRQEKLEQLAAR--FDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIF 468

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 469 AYEERVQAV 477



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 22/65 (33%), Positives = 42/65 (64%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ + Q QQ  + +  I   + E++  L+++DYGK L  V++L +KH+L+EAD++   E
Sbjct: 519 RLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGE 578

Query: 60  RIDAI 46
           R+  +
Sbjct: 579 RVKVV 583



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/70 (28%), Positives = 41/70 (58%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++L+E+ +  Q+     D E W+ E E  + +++ G DLT+V  +  KH  LE++++SH 
Sbjct: 629 SRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHD 688

Query: 63  ERIDAIREPG 34
            ++  + + G
Sbjct: 689 PQLQNVAKVG 698



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 40/67 (59%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ A +  Q     +D++ W+ +    + SED G+D  +VQ+L KKH  +  ++ ++AE
Sbjct: 736 RLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAE 795

Query: 60  RIDAIRE 40
            IDA+ +
Sbjct: 796 VIDALHK 802



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 19/68 (27%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L +A ++    +  +DI+ +++++E Q++S D   DLTSV  L +K  +++  ++ 
Sbjct: 1372 KGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNILMQKQQVIQTQMAV 1431

Query: 69   HAERIDAI 46
             A +++ I
Sbjct: 1432 KARQVEEI 1439



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +   LQ   +  Q+ R     E WL   E  LLS + G  +  V+NL KKH   E  
Sbjct: 2007 WEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKS 2066

Query: 78   VSSHAERIDAI 46
             ++  ER  A+
Sbjct: 2067 AAAQEERFSAL 2077



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 16/72 (22%), Positives = 36/72 (50%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            + +KL+EA    ++ R ++  + WL++ +  + SED    L   + L  +H  +  ++ +
Sbjct: 1051 RDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDN 1110

Query: 69   HAERIDAIREPG 34
            + E    + E G
Sbjct: 1111 YTEDYKNMMEYG 1122



 Score = 36.7 bits (81), Expect = 0.024
 Identities = 15/61 (24%), Positives = 33/61 (54%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD+ ++      ++++H+ F   ++AN  +++ +  V   L+E +HF   +I  R E + 
Sbjct: 1195 DDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENIT 1254

Query: 284  G 282
            G
Sbjct: 1255 G 1255



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -1

Query: 476  KFAT--DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            K+AT  D+SY     ++ K  +HQ FE E+ ANK R+ E     + L + +   +  I  
Sbjct: 1294 KYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEP 1353

Query: 302  RVEEL 288
            +++EL
Sbjct: 1354 KLKEL 1358



 Score = 32.3 bits (70), Expect = 0.52
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++  QQ +NR     E+ LS+ E  L  +D   +L   +N  K+H      + ++ ++
Sbjct: 1165 LSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDK 1224

Query: 57   IDAI 46
            I+ +
Sbjct: 1225 INTL 1228



 Score = 31.5 bits (68), Expect = 0.91
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            +L EA Q    +R V+D+E W+++ E    S++ G+D   V  L ++
Sbjct: 1694 RLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSER 1740



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/75 (18%), Positives = 37/75 (49%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +L+  +L +A    +     + +E W+ E    L +   GKD+  V+ ++ +    + ++
Sbjct: 836  KLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEM 895

Query: 75   SSHAERIDAIREPGR 31
            +++A R+  + +  R
Sbjct: 896  NANASRVAVVNQLAR 910



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 13/58 (22%), Positives = 32/58 (55%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N++   +K+Q+   E+  ++PR++ I   G++L++  H    +  + + +L   W+ L
Sbjct: 1521 NVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQEL 1578



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/60 (23%), Positives = 26/60 (43%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T +   D + +   +  HQ+ + E+   +       ++GK LL   H+A   I  R+  L
Sbjct: 1937 TSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTL 1996


>AF022656-1|AAB87867.1|  971|Drosophila melanogaster beta-H spectrin
           protein.
          Length = 971

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = -1

Query: 458 SYLDPTNLNGKV---QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           SY + TNL+ K+   QKHQ F+ E+ AN+ R+ EI   G  LL  +H + P+I   +E +
Sbjct: 639 SYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIV 698

Query: 287 GGIWERLV 264
              W+ L+
Sbjct: 699 LEAWQGLL 706



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L E+  + +Y    +++E W+ E E    SEDYG+D   +Q LQ K   L+  V   A+
Sbjct: 182 RLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGAD 241

Query: 60  RID 52
           R+D
Sbjct: 242 RVD 244



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +  KL  + + QQY     +IE WL E    L S +YG+D  S   L  KH  +E ++ +
Sbjct: 73  RSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDT 132

Query: 69  HA 64
           ++
Sbjct: 133 YS 134



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = -3

Query: 264 AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
           A  E +G  L+EA    ++N  ++ IE W+ + E  + + D G+DL     L +K   ++
Sbjct: 707 AELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVD 766

Query: 84  ADVSSHAERIDAIRE 40
           +D+    +R+  I +
Sbjct: 767 SDMRVDDQRVKHINQ 781



 Score = 35.9 bits (79), Expect = 0.042
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 833 FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 885



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  + A+ + Y  D  +L     K  + +  ++    RVD+   + K+L++ E     +
Sbjct: 204 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 263

Query: 311 ISSRVEELGGIWERLVQSSS*RE 243
           +  R E+L   WE L+Q  + RE
Sbjct: 264 VEKRQEQLRTSWENLLQLLNQRE 286



 Score = 34.7 bits (76), Expect = 0.098
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 204 RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
           R  + I+   S  +  L S D+G+ +  VQN  +KH   E  + +  E++  ++E GR
Sbjct: 511 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGR 568



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
           ++  K++KH  FE+ +Q  + +V  +   G++L+E  H+    I +
Sbjct: 538 DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQT 583



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = -3

Query: 144 DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRASS*KREP 7
           + G++L   Q+L KKH  LEA++  H   I+     G++   ++ P
Sbjct: 2   ELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP 47



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL  A +  +++R V +  L+  + +   LS++ G+DL S   L +KH   E D+ +   
Sbjct: 288 KLHAAGEIHRFHRDVAEA-LFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 346

Query: 60  RIDAIRE 40
           ++  + E
Sbjct: 347 QLQVLVE 353


>BT011160-1|AAR82828.1| 1410|Drosophila melanogaster AT24411p
           protein.
          Length = 1410

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 25/86 (29%), Positives = 46/86 (53%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +TD+   D T +N  + KH+  E E+ ++ P++  +  VG  L+   HF   +I  R++E
Sbjct: 659 STDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKE 718

Query: 290 LGGIWERLVQSSS*RETSCRKRLNNS 213
           +   W+ L+  +  R    R+RL N+
Sbjct: 719 ILNKWDHLLDLTKYR----RQRLENA 740



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/69 (30%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D+ 
Sbjct: 411 IRQEKLEQLAAR--FDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIF 468

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 469 AYEERVQAV 477



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 22/65 (33%), Positives = 42/65 (64%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ + Q QQ  + +  I   + E++  L+++DYGK L  V++L +KH+L+EAD++   E
Sbjct: 519 RLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGE 578

Query: 60  RIDAI 46
           R+  +
Sbjct: 579 RVKVV 583



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/70 (28%), Positives = 41/70 (58%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++L+E+ +  Q+     D E W+ E E  + +++ G DLT+V  +  KH  LE++++SH 
Sbjct: 629 SRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHD 688

Query: 63  ERIDAIREPG 34
            ++  + + G
Sbjct: 689 PQLQNVAKVG 698



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 40/67 (59%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ A +  Q     +D++ W+ +    + SED G+D  +VQ+L KKH  +  ++ ++AE
Sbjct: 736 RLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAE 795

Query: 60  RIDAIRE 40
            IDA+ +
Sbjct: 796 VIDALHK 802



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 16/72 (22%), Positives = 36/72 (50%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            + +KL+EA    ++ R ++  + WL++ +  + SED    L   + L  +H  +  ++ +
Sbjct: 1051 RDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDN 1110

Query: 69   HAERIDAIREPG 34
            + E    + E G
Sbjct: 1111 YTEDYKNMMEYG 1122



 Score = 36.7 bits (81), Expect = 0.024
 Identities = 15/61 (24%), Positives = 33/61 (54%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD+ ++      ++++H+ F   ++AN  +++ +  V   L+E +HF   +I  R E + 
Sbjct: 1195 DDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENIT 1254

Query: 284  G 282
            G
Sbjct: 1255 G 1255



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -1

Query: 476  KFAT--DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            K+AT  D+SY     ++ K  +HQ FE E+ ANK R+ E     + L + +   +  I  
Sbjct: 1294 KYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEP 1353

Query: 302  RVEEL 288
            +++EL
Sbjct: 1354 KLKEL 1358



 Score = 32.3 bits (70), Expect = 0.52
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++  QQ +NR     E+ LS+ E  L  +D   +L   +N  K+H      + ++ ++
Sbjct: 1165 LSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDK 1224

Query: 57   IDAI 46
            I+ +
Sbjct: 1225 INTL 1228



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/75 (18%), Positives = 37/75 (49%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +L+  +L +A    +     + +E W+ E    L +   GKD+  V+ ++ +    + ++
Sbjct: 836  KLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEM 895

Query: 75   SSHAERIDAIREPGR 31
            +++A R+  + +  R
Sbjct: 896  NANASRVAVVNQLAR 910


>AY069615-1|AAL39760.1|  895|Drosophila melanogaster LD37956p
           protein.
          Length = 895

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 400 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 457



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>AL031765-2|CAA21121.1|  924|Drosophila melanogaster
           EG:133E12.1,FBgn0000667;Actn protein.
          Length = 924

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 429 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 486



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
            +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 695  SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 754

Query: 260  SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
            S +        ++    + G S+      R   +      TGR+ P
Sbjct: 755  SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 800


>AL031765-1|CAA21120.1|  895|Drosophila melanogaster
           EG:133E12.1,FBgn0000667;Actn protein.
          Length = 895

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 400 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 457



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>AL009192-4|CAA15688.1|  895|Drosophila melanogaster
           EG:133E12.1,FBgn0000667;Actn protein.
          Length = 895

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 400 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 457



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>AL009192-3|CAA15689.1|  924|Drosophila melanogaster
           EG:133E12.1,FBgn0000667;Actn protein.
          Length = 924

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 429 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 486



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
            +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 695  SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 754

Query: 260  SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
            S +        ++    + G S+      R   +      TGR+ P
Sbjct: 755  SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 800


>AE014298-311|AAF45705.2|  917|Drosophila melanogaster CG4376-PC,
           isoform C protein.
          Length = 917

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 422 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 479



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
            +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 688  SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 747

Query: 260  SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
            S +        ++    + G S+      R   +      TGR+ P
Sbjct: 748  SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 793


>AE014298-310|AAF45706.2|  895|Drosophila melanogaster CG4376-PB,
           isoform B protein.
          Length = 895

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 400 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 457



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>AE014298-309|AAN09068.1|  895|Drosophila melanogaster CG4376-PA,
           isoform A protein.
          Length = 895

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 400 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 457



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB,
            isoform B protein.
          Length = 7744

 Score = 35.1 bits (77), Expect = 0.074
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSED--YGKDLTSVQNLQKKHALLEADVSSHAE 61
            QE      Y+++++D+E WL ++  QL++ +  +  +    Q   K+H  L  ++  +  
Sbjct: 5779 QEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQT 5838

Query: 60   RIDAIREPGRA 28
             +D +   G+A
Sbjct: 5839 NLDDLNAKGQA 5849



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEAD 79
            ++KG   +      QY ++ E I  WL +VEG++ +E   + +L+ V    ++ ++L+ D
Sbjct: 2461 QIKGILDENVDLWSQYEQSNEQISNWLRDVEGRVKAETSSQVNLSEVPQKLQELSILQQD 2520

Query: 78   VSSHAERIDAIRE 40
            V +H   I+ + +
Sbjct: 2521 VLAHEPIINNLEQ 2533


>AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-PD,
            isoform D protein.
          Length = 11707

 Score = 35.1 bits (77), Expect = 0.074
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSED--YGKDLTSVQNLQKKHALLEADVSSHAE 61
            QE      Y+++++D+E WL ++  QL++ +  +  +    Q   K+H  L  ++  +  
Sbjct: 5779 QEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQT 5838

Query: 60   RIDAIREPGRA 28
             +D +   G+A
Sbjct: 5839 NLDDLNAKGQA 5849



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEAD 79
            ++KG   +      QY ++ E I  WL +VEG++ +E   + +L+ V    ++ ++L+ D
Sbjct: 2461 QIKGILDENVDLWSQYEQSNEQISNWLRDVEGRVKAETSSQVNLSEVPQKLQELSILQQD 2520

Query: 78   VSSHAERIDAIRE 40
            V +H   I+ + +
Sbjct: 2521 VLAHEPIINNLEQ 2533


>AF216663-1|AAF32293.1| 2263|Drosophila melanogaster
           guanine-nucleotide-exchange-factorTRIO protein.
          Length = 2263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>AF215635-1|AAF25952.1| 2263|Drosophila melanogaster Rho family
           guanine nucleotideexchange factor Trio protein.
          Length = 2263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>AE014296-165|AAN11455.1| 2263|Drosophila melanogaster CG18214-PC,
           isoform C protein.
          Length = 2263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>AE014296-164|AAF47436.3| 2263|Drosophila melanogaster CG18214-PA,
           isoform A protein.
          Length = 2263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>AB035419-1|BAA96093.1| 2263|Drosophila melanogaster Trio protein.
          Length = 2263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>Y09430-1|CAA70581.1| 4151|Drosophila melanogaster Kakapo protein.
          Length = 4151

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 3351 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 3408

Query: 269  L 267
            +
Sbjct: 3409 V 3409



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 2359 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 2396



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 3092 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 3150

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 3151 HREAMLLLDKKG 3162



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 2703 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 2760



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 3527 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 3586

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 3587 ARRQNEVDRACKPRQLPPGARKP 3609


>AY122181-1|AAM52693.1| 1140|Drosophila melanogaster LD39385p
           protein.
          Length = 1140

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 338 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 395

Query: 269 L 267
           +
Sbjct: 396 V 396



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240 KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
           KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 79  KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 137

Query: 69  HAERIDAIREPG 34
           H E +  + + G
Sbjct: 138 HREAMLLLDKKG 149



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243 NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
           +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 514 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 573

Query: 75  SSHAERIDAIREPGRASS*KREP 7
           +     +D   +P +     R+P
Sbjct: 574 ARRQNEVDRACKPRQLPPGARKP 596


>AF200425-1|AAF24343.1| 5201|Drosophila melanogaster Short stop/Kakapo
            long isoform protein.
          Length = 5201

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4397 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4454

Query: 269  L 267
            +
Sbjct: 4455 V 4455



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3405 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3442



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4138 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4196

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4197 HREAMLLLDKKG 4208



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 3749 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 3806



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4573 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4632

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4633 ARRQNEVDRACKPRQLPPGARKP 4655


>AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-PH,
            isoform H protein.
          Length = 8805

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 8001 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 8058

Query: 269  L 267
            +
Sbjct: 8059 V 8059



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 7009 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 7046



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 7742 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 7800

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 7801 HREAMLLLDKKG 7812



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 7353 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 7410



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 8177 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 8236

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 8237 ARRQNEVDRACKPRQLPPGARKP 8259


>AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-PC,
            isoform C protein.
          Length = 5160

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4356 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4413

Query: 269  L 267
            +
Sbjct: 4414 V 4414



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3364 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3401



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4097 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4155

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4156 HREAMLLLDKKG 4167



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 3708 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 3765



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4532 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4591

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4592 ARRQNEVDRACKPRQLPPGARKP 4614


>AE013599-1790|AAF58319.3| 5501|Drosophila melanogaster CG18076-PA,
            isoform A protein.
          Length = 5501

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4697 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4754

Query: 269  L 267
            +
Sbjct: 4755 V 4755



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3705 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3742



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4438 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4496

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4497 HREAMLLLDKKG 4508



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 4049 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 4106



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4873 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4932

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4933 ARRQNEVDRACKPRQLPPGARKP 4955


>AE013599-1789|AAM68561.1| 5201|Drosophila melanogaster CG18076-PE,
            isoform E protein.
          Length = 5201

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4397 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4454

Query: 269  L 267
            +
Sbjct: 4455 V 4455



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3405 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3442



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4138 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4196

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4197 HREAMLLLDKKG 4208



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 3749 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 3806



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4573 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4632

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4633 ARRQNEVDRACKPRQLPPGARKP 4655


>AE013599-1788|AAG22268.2| 5390|Drosophila melanogaster CG18076-PB,
            isoform B protein.
          Length = 5390

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4586 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4643

Query: 269  L 267
            +
Sbjct: 4644 V 4644



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3594 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3631



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4327 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4385

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4386 HREAMLLLDKKG 4397



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 3938 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 3995



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4762 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4821

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4822 ARRQNEVDRACKPRQLPPGARKP 4844


>AE013599-1787|AAF58317.1| 5385|Drosophila melanogaster CG18076-PG,
            isoform G protein.
          Length = 5385

 Score = 31.5 bits (68), Expect = 0.91
 Identities = 14/61 (22%), Positives = 31/61 (50%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   + G  + H++ EQ+LQ    ++  +   G+ L    +   P++  +++E+  IWE 
Sbjct: 4586 DLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN--NPEVGRQLDEMQSIWEE 4643

Query: 269  L 267
            +
Sbjct: 4644 V 4644



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/38 (26%), Positives = 25/38 (65%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            ++P  +  ++Q+H++   ++ + K RV ++TA  K++L
Sbjct: 3594 MEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVL 3631



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQ-QYNRAVEDIELWLSEVEGQLLS--EDYGKDLTSVQNLQKKHALLEADVSS 70
            KL+ A ++  +++  ++    WL++ E +LLS  E   + L ++Q   ++H +L+ DVS+
Sbjct: 4327 KLEIALKEATEFHDTLQAFVEWLTQAE-KLLSNAEPVSRVLETIQAQMEEHKVLQKDVST 4385

Query: 69   HAERIDAIREPG 34
            H E +  + + G
Sbjct: 4386 HREAMLLLDKKG 4397



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -1

Query: 413  QNFEQELQANKPRVDEITAVGKRLLEL-EHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            Q    E+   KP V+++   G  L+ +     +P++   +E+L   W+ +    + RE
Sbjct: 3938 QEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKRE 3995



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 243  NKLQEAAQQ-QQYNRAVEDIELWLSEVEGQLLS---EDYGKDLTSVQNLQKKHALLEADV 76
            +KL++  Q  +  +  +E++  WLS +EG LL+   E    ++  V+ L + H     + 
Sbjct: 4762 SKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENT 4821

Query: 75   SSHAERIDAIREPGRASS*KREP 7
            +     +D   +P +     R+P
Sbjct: 4822 ARRQNEVDRACKPRQLPPGARKP 4844


>X51753-1|CAA36042.1|  895|Drosophila melanogaster protein (
           Drosophila lethal(1)2Cb gene for sarcomeric alpha
           actinin. ).
          Length = 895

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           +L  ++ + + +EQ + A KP ++E+  + + + E   F     +  +E L   WE+L+ 
Sbjct: 666 SLEDQLHRLKEYEQAVHAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLT 725

Query: 260 SSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*P 123
           S +        ++    + G S+      R   +      TGR+ P
Sbjct: 726 SINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSP 771


>BT030453-1|ABP87895.1|  980|Drosophila melanogaster IP18281p
           protein.
          Length = 980

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYG 136
           Q+  QQQQ  ++  DI+++ S   GQL +E  G
Sbjct: 280 QQQQQQQQQQQSTADIDVYDSPFNGQLSAERIG 312


>AY051730-1|AAK93154.1|  550|Drosophila melanogaster LD25919p
           protein.
          Length = 550

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = -1

Query: 392 QANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN- 216
           +A K R ++I A  K+ LE   FA+  +SS++EE+   ++ L   S     +  K++N+ 
Sbjct: 9   RAVKEREEQIEAA-KQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQ 67

Query: 215 -SSTTGPSRTLNFG 177
                   R+LN G
Sbjct: 68  IEKLAANVRSLNVG 81


>AF427496-1|AAL25120.1|  734|Drosophila melanogaster occludin-like
           protein protein.
          Length = 734

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEG-QLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREP 37
           QYN+ VEDI L   E+      SE     + S  +++K+   L+  ++    RI A+ E 
Sbjct: 488 QYNQRVEDIRLLKKEISNLHTESECLKHAIKSTADMRKEIVRLQRALNQEHIRIRALTED 547

Query: 36  GR 31
            R
Sbjct: 548 AR 549


>AF203342-1|AAF13280.1| 1729|Drosophila melanogaster pericardine
            protein.
          Length = 1729

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = -3

Query: 441  QPEWQGAETSELRTG-AAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATG 265
            Q    G  +S+ + G   GQ+A+    NG  QAS+ + T  S S+    G +   +   G
Sbjct: 1379 QSSGPGQTSSQAQIGFRPGQEANPIAANGGGQASSSSGTHSSQSSSQIHGTSSFGVSYHG 1438

Query: 264  AVFELKGNKLQEAAQQQQYNR 202
            A     G K ++ A  ++ NR
Sbjct: 1439 AAQSASGTK-EQVATYREANR 1458


>AF186472-1|AAF01416.1| 1409|Drosophila melanogaster condensin subunit
            SMC4 protein.
          Length = 1409

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = -1

Query: 392  QANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN- 216
            +A K R ++I A  K+ LE   FA+  +SS++EE+   ++ L   S     +  K++N+ 
Sbjct: 868  RAVKEREEQIEAA-KQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQ 926

Query: 215  -SSTTGPSRTLNFG 177
                    R+LN G
Sbjct: 927  IEKLAANVRSLNVG 940


>AF185287-1|AAF13306.1| 1409|Drosophila melanogaster XCAP-C/SMC4
            homolog Gluon protein.
          Length = 1409

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = -1

Query: 392  QANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN- 216
            +A K R ++I A  K+ LE   FA+  +SS++EE+   ++ L   S     +  K++N+ 
Sbjct: 868  RAVKEREEQIEAA-KQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQ 926

Query: 215  -SSTTGPSRTLNFG 177
                    R+LN G
Sbjct: 927  IEKLAANVRSLNVG 940


>AF160943-1|AAD46883.2| 1012|Drosophila melanogaster LD20207p protein.
          Length = 1012

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = -1

Query: 392  QANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN- 216
            +A K R ++I A  K+ LE   FA+  +SS++EE+   ++ L   S     +  K++N+ 
Sbjct: 868  RAVKEREEQIEAA-KQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQ 926

Query: 215  -SSTTGPSRTLNFG 177
                    R+LN G
Sbjct: 927  IEKLAANVRSLNVG 940


>AE014297-1515|AAF54807.1| 2016|Drosophila melanogaster CG6525-PA
           protein.
          Length = 2016

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +3

Query: 138 RSPR*AAVLQLPRAKVQCPRRPGCTAVVEPLPATCFPSARRLHQSLP 278
           ++P+   ++Q+P  K      P   A+   LP+T F   R  HQSLP
Sbjct: 429 KAPQIGQIIQMPATKSV----PAVFALGRGLPSTSFLKIRPTHQSLP 471


>AE014296-2068|AAF49980.2| 1713|Drosophila melanogaster CG5700-PB
            protein.
          Length = 1713

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = -3

Query: 441  QPEWQGAETSELRTG-AAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATG 265
            Q    G  +S+ + G   GQ+A+    NG  QAS+ + T  S S+    G +   +   G
Sbjct: 1363 QSSGPGQTSSQAQIGFRPGQEANPIAANGGGQASSSSGTHSSQSSSQIHGTSSFGVSYHG 1422

Query: 264  AVFELKGNKLQEAAQQQQYNR 202
            A     G K ++ A  ++ NR
Sbjct: 1423 AAQSASGTK-EQVATYREANR 1442


>AE014134-2761|AAF53560.1| 1409|Drosophila melanogaster CG11397-PA
            protein.
          Length = 1409

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = -1

Query: 392  QANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN- 216
            +A K R ++I A  K+ LE   FA+  +SS++EE+   ++ L   S     +  K++N+ 
Sbjct: 868  RAVKEREEQIEAA-KQELEQAQFAEQAVSSQIEEIQNQYDTLRNESVKPVEAKIKKVNSQ 926

Query: 215  -SSTTGPSRTLNFG 177
                    R+LN G
Sbjct: 927  IEKLAANVRSLNVG 940


>AE014134-2707|AAN10938.1| 2282|Drosophila melanogaster CG31817-PA
           protein.
          Length = 2282

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 35/117 (29%), Positives = 53/117 (45%), Gaps = 4/117 (3%)
 Frame = -1

Query: 428 KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS* 249
           K Q+ Q  ++  +  K   D+     + L E+E F Q +  S++ E     ERLVQSSS 
Sbjct: 525 KNQEKQRNQESFEQTKS--DKTNFQSQPLNEVE-FKQQKTKSQIIESQEDQERLVQSSS- 580

Query: 248 RETSCRKRLNNSSTTGPSRTLNFGSRKLKD----SCSARTTGRI*PACRISRRSTRC 90
            ET   K       T P +     ++K K     SC +RT+ R   A + + +S  C
Sbjct: 581 -ETLLPK------VTAPKKKKLISTKKRKSSRSCSCCSRTSSRKRSAKKPTTKSQVC 630


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,945,227
Number of Sequences: 53049
Number of extensions: 518194
Number of successful extensions: 2505
Number of sequences better than 10.0: 51
Number of HSP's better than 10.0 without gapping: 1976
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2494
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2462276481
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).