SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   103   6e-23
K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   103   6e-23
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   103   6e-23
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   103   6e-23
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   103   6e-23
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   103   6e-23
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   103   6e-23
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   103   6e-23
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   103   6e-23
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   103   6e-23
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   103   8e-23
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   103   8e-23
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   103   8e-23
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   103   8e-23
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   103   8e-23
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   103   8e-23
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   103   8e-23
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   103   8e-23
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   103   8e-23
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   103   8e-23
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   103   8e-23
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   103   8e-23
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    103   8e-23
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...    99   1e-21
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...    99   1e-21
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...    99   1e-21
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...    99   1e-21
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...    80   1e-15
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...    64   6e-11
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...    64   6e-11
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...    63   1e-10
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...    61   4e-10
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...    61   4e-10
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...    61   4e-10
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    46   1e-05
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    46   1e-05
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    46   1e-05
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    39   0.003
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    38   0.006
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    38   0.006
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    36   0.019
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    36   0.019
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.24 
U09306-1|AAB60255.1| 1106|Drosophila melanogaster shuttle craft ...    29   2.2  
AF145679-1|AAD38654.1| 1106|Drosophila melanogaster BcDNA.LD2272...    29   2.2  
AE014134-2570|AAN10891.1| 1099|Drosophila melanogaster CG3647-PA...    29   2.2  
AE014134-2569|AAF53441.2| 1106|Drosophila melanogaster CG3647-PB...    29   2.2  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   3.8  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   3.8  
AY051979-1|AAK93403.1| 1693|Drosophila melanogaster LD44801p pro...    28   5.1  
AE014297-573|AAF54052.2| 1693|Drosophila melanogaster CG2507-PB,...    28   5.1  
X95250-1|CAA64539.1|  192|Drosophila melanogaster Not22 protein.       27   6.7  
BT022388-1|AAY54804.1|  364|Drosophila melanogaster IP11532p pro...    27   6.7  
AE014134-2521|AAF53409.1|  364|Drosophila melanogaster CG4697-PA...    27   6.7  
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    27   8.9  
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    27   8.9  
AE013599-3457|AAF46894.2| 1227|Drosophila melanogaster CG30268-P...    27   8.9  

>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  103 bits (248), Expect = 6e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 5e-16
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 74.9 bits (176), Expect = 3e-14
 Identities = 32/39 (82%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 74.9 bits (176), Expect = 3e-14
 Identities = 32/39 (82%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 21  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 67



 Score = 48.0 bits (109), Expect = 4e-06
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = +2

Query: 191 MCKAGFAGYDAPRAVFPSIVGSP 259
           MCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP 23


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 74.9 bits (176), Expect = 3e-14
 Identities = 32/39 (82%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  103 bits (247), Expect = 8e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 74.9 bits (176), Expect = 3e-14
 Identities = 32/39 (82%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =   99 bits (238), Expect = 1e-21
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKD YVGDEAQSKRGIL+LKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDM 83



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 35/39 (89%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEE +ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =   99 bits (238), Expect = 1e-21
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKD YVGDEAQSKRGIL+LKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDM 83



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 35/39 (89%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEE +ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =   99 bits (238), Expect = 1e-21
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKD YVGDEAQSKRGIL+LKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDM 83



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 35/39 (89%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEE +ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =   99 bits (238), Expect = 1e-21
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKD YVGDEAQSKRGIL+LKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDM 83



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 35/39 (89%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEE +ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 36/39 (92%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD+EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39



 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = +1

Query: 250 GKPRHQGVMVGM 285
           G+PRHQGVMVGM
Sbjct: 37  GRPRHQGVMVGM 48


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score = 64.1 bits (149), Expect = 6e-11
 Identities = 27/47 (57%), Positives = 34/47 (72%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH  V++     DS +G+ A  KRGILTLKYPIEHG+  NWD+M
Sbjct: 34  GRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPIEHGMVKNWDEM 80



 Score = 58.4 bits (135), Expect = 3e-09
 Identities = 25/33 (75%), Positives = 29/33 (87%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           AA+V+DNGSG+CKAGF+  D PRAVFPSIVG P
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRP 36


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score = 64.1 bits (149), Expect = 6e-11
 Identities = 27/47 (57%), Positives = 34/47 (72%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH  V++     DS +G+ A  KRGILTLKYPIEHG+  NWD+M
Sbjct: 42  GRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPIEHGMVKNWDEM 88



 Score = 58.4 bits (135), Expect = 3e-09
 Identities = 25/33 (75%), Positives = 29/33 (87%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           AA+V+DNGSG+CKAGF+  D PRAVFPSIVG P
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRP 44


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 62.9 bits (146), Expect = 1e-10
 Identities = 26/47 (55%), Positives = 33/47 (70%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH  V++     DS +G+    KRGILTLKYPIEHG+  NWD+M
Sbjct: 42  GRPRHLNVLLDSVIGDSVIGERQPEKRGILTLKYPIEHGMVKNWDEM 88



 Score = 58.4 bits (135), Expect = 3e-09
 Identities = 25/33 (75%), Positives = 29/33 (87%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           AA+V+DNGSG+CKAGF+  D PRAVFPSIVG P
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRP 44


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 61.3 bits (142), Expect = 4e-10
 Identities = 23/47 (48%), Positives = 36/47 (76%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D +VG +A+  RG+L+++YP+EHGI T+W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDM 86



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/31 (54%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ +G P
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRP 42


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score = 61.3 bits (142), Expect = 4e-10
 Identities = 23/47 (48%), Positives = 36/47 (76%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D +VG +A+  RG+L+++YP+EHGI T+W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDM 86



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/31 (54%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ +G P
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRP 42


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score = 61.3 bits (142), Expect = 4e-10
 Identities = 23/47 (48%), Positives = 36/47 (76%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D +VG +A+  RG+L+++YP+EHGI T+W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDM 86



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/31 (54%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ +G P
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRP 42


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+E+G+  NWDDM
Sbjct: 54  KDLMVGDEASQLRSLLEVSYPMENGVVRNWDDM 86



 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FPS+VG P IRA
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRA 44


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+E+G+  NWDDM
Sbjct: 53  KDLMVGDEASQLRSLLEVSYPMENGVVRNWDDM 85



 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FPS+VG P IRA
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRA 43


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+E+G+  NWDDM
Sbjct: 53  KDLMVGDEASQLRSLLEVSYPMENGVVRNWDDM 85



 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FPS+VG P IRA
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRA 43


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G    + +  G+   D ++GDEA  + G  ++KYP+ HG+  +WD M
Sbjct: 44  GDTNTRRITKGIEDLDFFIGDEAFDRTGY-SIKYPVRHGLVEDWDLM 89



 Score = 31.5 bits (68), Expect = 0.41
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A V+D G+G  K GFAG   P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.006
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G    + +  G+   D ++GDEA    G  ++KYP+ HG+  +WD M
Sbjct: 44  GDTNTRRITKGIEDLDFFIGDEAFDATGY-SIKYPVRHGLVEDWDLM 89



 Score = 31.5 bits (68), Expect = 0.41
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A V+D G+G  K GFAG   P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 37.5 bits (83), Expect = 0.006
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G    + +  G+   D ++GDEA    G  ++KYP+ HG+  +WD M
Sbjct: 44  GDTNTRRITKGIEDLDFFIGDEAFDATGY-SIKYPVRHGLVEDWDLM 89



 Score = 31.5 bits (68), Expect = 0.41
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A V+D G+G  K GFAG   P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 35.9 bits (79), Expect = 0.019
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +E+ ALV D G    + G+A  D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 35.9 bits (79), Expect = 0.019
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +E+ ALV D G    + G+A  D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.24
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGS 187
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>U09306-1|AAB60255.1| 1106|Drosophila melanogaster shuttle craft
           protein protein.
          Length = 1106

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 121 RCRCDKMKIKRPAVTANREKQIPDCRPGAGTPAP 20
           +C C K + K P    +++K+   C+   G P P
Sbjct: 551 QCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLP 584


>AF145679-1|AAD38654.1| 1106|Drosophila melanogaster BcDNA.LD22726
           protein.
          Length = 1106

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 121 RCRCDKMKIKRPAVTANREKQIPDCRPGAGTPAP 20
           +C C K + K P    +++K+   C+   G P P
Sbjct: 551 QCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLP 584


>AE014134-2570|AAN10891.1| 1099|Drosophila melanogaster CG3647-PA,
           isoform A protein.
          Length = 1099

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 121 RCRCDKMKIKRPAVTANREKQIPDCRPGAGTPAP 20
           +C C K + K P    +++K+   C+   G P P
Sbjct: 544 QCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLP 577


>AE014134-2569|AAF53441.2| 1106|Drosophila melanogaster CG3647-PB,
           isoform B protein.
          Length = 1106

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 121 RCRCDKMKIKRPAVTANREKQIPDCRPGAGTPAP 20
           +C C K + K P    +++K+   C+   G P P
Sbjct: 551 QCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLP 584


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 143 MCDEEVAALVVD 178
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 143 MCDEEVAALVVD 178
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>AY051979-1|AAK93403.1| 1693|Drosophila melanogaster LD44801p protein.
          Length = 1693

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = -3

Query: 258  GLPTIEGNTARGASYPAKPALHIPEPLSTTNAATSSSHI 142
            G+  ++G T    SYP  P L +P+     +  T   H+
Sbjct: 1200 GIAIVDGQTVAYESYPVIPGLGVPQHHPQQHQTTPQQHL 1238


>AE014297-573|AAF54052.2| 1693|Drosophila melanogaster CG2507-PB,
            isoform B protein.
          Length = 1693

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = -3

Query: 258  GLPTIEGNTARGASYPAKPALHIPEPLSTTNAATSSSHI 142
            G+  ++G T    SYP  P L +P+     +  T   H+
Sbjct: 1200 GIAIVDGQTVAYESYPVIPGLGVPQHHPQQHQTTPQQHL 1238


>X95250-1|CAA64539.1|  192|Drosophila melanogaster Not22 protein.
          Length = 192

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -2

Query: 277 PSRPDGGASHDRGKHCARSIISCEAGLAHTG 185
           P R  GGA H RG H A ++     G  H G
Sbjct: 42  PLRAPGGAGHQRGGHPAGALHRDRLGGLHAG 72


>BT022388-1|AAY54804.1|  364|Drosophila melanogaster IP11532p
           protein.
          Length = 364

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -2

Query: 217 ISCEAGLAHTGAIVYYQRGNFFVA 146
           +SC AGLAH G  +Y     +F++
Sbjct: 221 LSCVAGLAHLGLKIYKSAAQYFLS 244


>AE014134-2521|AAF53409.1|  364|Drosophila melanogaster CG4697-PA
           protein.
          Length = 364

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -2

Query: 217 ISCEAGLAHTGAIVYYQRGNFFVA 146
           +SC AGLAH G  +Y     +F++
Sbjct: 221 LSCVAGLAHLGLKIYKSAAQYFLS 244


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           LV+DNGS  C+ G++    P   F +++  P
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKP 37


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           LV+DNGS  C+ G++    P   F +++  P
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKP 37


>AE013599-3457|AAF46894.2| 1227|Drosophila melanogaster CG30268-PA
           protein.
          Length = 1227

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 19/73 (26%), Positives = 33/73 (45%)
 Frame = +1

Query: 145 VRRRSCRVGSRQWLRYVQGRLRRI*CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQS 324
           VR    R+  R W+R+V G ++ I    + V L  G   +   +V MG    Y  ++ + 
Sbjct: 761 VRDTMQRMDVRHWVRFVSGEVKSIKRQEKVVELSDGCHLYYDKLVLMG-ATRYGFEDKEF 819

Query: 325 KRGILTLKYPIEH 363
           K   + L Y + +
Sbjct: 820 KGHPIPLNYVVNN 832


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,319,701
Number of Sequences: 53049
Number of extensions: 468258
Number of successful extensions: 1547
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 1449
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1547
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1107890535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).