SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04427-1|CAA28024.1|  541|Drosophila melanogaster yellow gene pr...    76   4e-14
AL023873-2|CAA19640.1|  541|Drosophila melanogaster EG:125H10.2,...    76   4e-14
AE014298-26|AAF45497.1|  541|Drosophila melanogaster CG3757-PA p...    76   4e-14
AY113601-1|AAM29606.1|  438|Drosophila melanogaster RH54244p pro...    65   5e-11
AE014134-2553|AAF53432.3|  438|Drosophila melanogaster CG4182-PA...    65   5e-11
AY071114-1|AAL48736.1|  358|Drosophila melanogaster RE16722p pro...    54   1e-07
AE014135-44|AAF59358.2|  463|Drosophila melanogaster CG1629-PA p...    54   1e-07
AY118575-1|AAM49944.1|  453|Drosophila melanogaster LD43175p pro...    47   2e-05
AF237613-1|AAF60328.1|  453|Drosophila melanogaster YELLOW-B pro...    47   2e-05
AE014134-2765|AAF53564.1|  453|Drosophila melanogaster CG17914-P...    47   2e-05
AY060728-1|AAL28276.1|  452|Drosophila melanogaster GH17451p pro...    42   4e-04
AE014297-1606|AAF54885.2|  452|Drosophila melanogaster CG8063-PA...    42   4e-04
BT003613-1|AAO39616.1|  447|Drosophila melanogaster GH16592p pro...    40   0.003
AE014297-1605|AAF54884.1|  429|Drosophila melanogaster CG18550-P...    40   0.003
AE014297-1687|AAF54947.1|  426|Drosophila melanogaster CG17044-P...    33   0.26 
AY121706-1|AAM52033.1|  412|Drosophila melanogaster RH49821p pro...    32   0.46 
AE013599-3590|AAF46993.1|  412|Drosophila melanogaster CG9891-PA...    32   0.46 
U69607-1|AAD08845.1|  493|Drosophila melanogaster amylase-like p...    32   0.60 
AE014296-437|AAF47631.1|  393|Drosophila melanogaster CG5717-PA ...    31   0.80 
AY052055-1|AAK93479.1|  493|Drosophila melanogaster LP08070p pro...    30   1.8  
AF022713-3|AAD09147.2|  493|Drosophila melanogaster putative amy...    30   1.8  
AE013599-2321|AAF57971.1|  493|Drosophila melanogaster CG8221-PA...    30   1.8  
AY118746-1|AAM50606.1|  739|Drosophila melanogaster GH05829p pro...    28   7.4  
AE014296-438|AAF47632.1|  382|Drosophila melanogaster CG13804-PA...    28   7.4  
AE013599-3094|AAF46647.5|  739|Drosophila melanogaster CG9313-PA...    28   7.4  

>X04427-1|CAA28024.1|  541|Drosophila melanogaster yellow gene
           protein.
          Length = 541

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +2

Query: 62  LVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 241
           LV+ + A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+V
Sbjct: 15  LVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTV 74

Query: 242 PRWR 253
           PRWR
Sbjct: 75  PRWR 78



 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFGY*TFG 435
           GIPATL YI +D     SP+L PYP +  N  G+C   +TT YR+K D+   ++   T G
Sbjct: 80  GIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDT-G 138

Query: 436 TYGYDN-VTNVCP 471
           T G  N  TN CP
Sbjct: 139 TVGIGNTTTNPCP 151


>AL023873-2|CAA19640.1|  541|Drosophila melanogaster
           EG:125H10.2,FBgn0004034;y protein.
          Length = 541

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +2

Query: 62  LVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 241
           LV+ + A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+V
Sbjct: 15  LVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTV 74

Query: 242 PRWR 253
           PRWR
Sbjct: 75  PRWR 78



 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFGY*TFG 435
           GIPATL YI +D     SP+L PYP +  N  G+C   +TT YR+K D+   ++   T G
Sbjct: 80  GIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDT-G 138

Query: 436 TYGYDN-VTNVCP 471
           T G  N  TN CP
Sbjct: 139 TVGIGNTTTNPCP 151


>AE014298-26|AAF45497.1|  541|Drosophila melanogaster CG3757-PA
           protein.
          Length = 541

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +2

Query: 62  LVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 241
           LV+ + A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+V
Sbjct: 15  LVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTV 74

Query: 242 PRWR 253
           PRWR
Sbjct: 75  PRWR 78



 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFGY*TFG 435
           GIPATL YI +D     SP+L PYP +  N  G+C   +TT YR+K D+   ++   T G
Sbjct: 80  GIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDT-G 138

Query: 436 TYGYDN-VTNVCP 471
           T G  N  TN CP
Sbjct: 139 TVGIGNTTTNPCP 151


>AY113601-1|AAM29606.1|  438|Drosophila melanogaster RH54244p
           protein.
          Length = 438

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 26/58 (44%), Positives = 42/58 (72%)
 Frame = +2

Query: 80  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW+
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWK 80



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +1

Query: 199 RWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNEL 351
           RW  ++   + R ++    G+ ATLNYI +++  E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKA----GVAATLNYIDINST-EKSPKLHPYPSWEANKL 112


>AE014134-2553|AAF53432.3|  438|Drosophila melanogaster CG4182-PA
           protein.
          Length = 438

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 26/58 (44%), Positives = 42/58 (72%)
 Frame = +2

Query: 80  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW+
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWK 80



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +1

Query: 199 RWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNEL 351
           RW  ++   + R ++    G+ ATLNYI +++  E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKA----GVAATLNYIDINST-EKSPKLHPYPSWEANKL 112


>AY071114-1|AAL48736.1|  358|Drosophila melanogaster RE16722p
           protein.
          Length = 358

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 20/55 (36%), Positives = 36/55 (65%)
 Frame = +2

Query: 89  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW+
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWK 106


>AE014135-44|AAF59358.2|  463|Drosophila melanogaster CG1629-PA
           protein.
          Length = 463

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 20/55 (36%), Positives = 36/55 (65%)
 Frame = +2

Query: 89  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW+
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWK 106


>AY118575-1|AAM49944.1|  453|Drosophila melanogaster LD43175p
           protein.
          Length = 453

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 74  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PA+L Y+ L+      P L P+PS++ + L   +  L + +RV+AD+
Sbjct: 77  GVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADR 125


>AF237613-1|AAF60328.1|  453|Drosophila melanogaster YELLOW-B
           protein.
          Length = 453

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 74  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PA+L Y+ L+      P L P+PS++ + L   +  L + +RV+AD+
Sbjct: 77  GVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADR 125


>AE014134-2765|AAF53564.1|  453|Drosophila melanogaster CG17914-PA
           protein.
          Length = 453

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 74  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PA+L Y+ L+      P L P+PS++ + L   +  L + +RV+AD+
Sbjct: 77  GVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADR 125


>AY060728-1|AAL28276.1|  452|Drosophila melanogaster GH17451p
           protein.
          Length = 452

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 253 LGIPATLNYIPL-DAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           +GIP+TLNYI L +     SPKL  YP+F  N+       L +VYR   D
Sbjct: 122 VGIPSTLNYIDLAEDGSNRSPKLRAYPNFALNQFNASAENLVSVYRTSVD 171



 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +2

Query: 179 IPENALPVGIERWRNKLFVSVPRWR 253
           IP N +P+G   +R +LFV++PR R
Sbjct: 97  IPYNNVPMGATHFRGRLFVTMPRRR 121


>AE014297-1606|AAF54885.2|  452|Drosophila melanogaster CG8063-PA
           protein.
          Length = 452

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 253 LGIPATLNYIPL-DAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           +GIP+TLNYI L +     SPKL  YP+F  N+       L +VYR   D
Sbjct: 122 VGIPSTLNYIDLAEDGSNRSPKLRAYPNFALNQFNASAENLVSVYRTSVD 171



 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +2

Query: 179 IPENALPVGIERWRNKLFVSVPRWR 253
           IP N +P+G   +R +LFV++PR R
Sbjct: 97  IPYNNVPMGATHFRGRLFVTMPRRR 121


>BT003613-1|AAO39616.1|  447|Drosophila melanogaster GH16592p
           protein.
          Length = 447

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLDAP-YEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           GIP+TLNYI L    +  SP L  YP+   N+    +  L +VYR   D
Sbjct: 118 GIPSTLNYIDLAKDGWSQSPHLRAYPNLAVNQYNASEQNLVSVYRTSVD 166



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 167 TGALIPENALPVGIERWRNKLFVSVPR 247
           +G+ I  N +P G+  +R +LFV+VPR
Sbjct: 88  SGSFIQYNNVPQGVTHFRGRLFVTVPR 114


>AE014297-1605|AAF54884.1|  429|Drosophila melanogaster CG18550-PA
           protein.
          Length = 429

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLDAP-YEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           GIP+TLNYI L    +  SP L  YP+   N+    +  L +VYR   D
Sbjct: 100 GIPSTLNYIDLAKDGWSQSPHLRAYPNLAVNQYNASEQNLVSVYRTSVD 148



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 167 TGALIPENALPVGIERWRNKLFVSVPR 247
           +G+ I  N +P G+  +R +LFV+VPR
Sbjct: 70  SGSFIQYNNVPQGVTHFRGRLFVTVPR 96


>AE014297-1687|AAF54947.1|  426|Drosophila melanogaster CG17044-PA
           protein.
          Length = 426

 Score = 33.1 bits (72), Expect = 0.26
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 211
           +F W  + + +P +  + Q LR G   P++ +P+ I+
Sbjct: 35  VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDID 71


>AY121706-1|AAM52033.1|  412|Drosophila melanogaster RH49821p
           protein.
          Length = 412

 Score = 32.3 bits (70), Expect = 0.46
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 8/78 (10%)
 Frame = +2

Query: 41  KFLVF--CGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIER 214
           +++VF  C    LA++   L+ +F    ++  +P    +Q+ALR G   P + +P+ ++ 
Sbjct: 3   RWIVFGVCCWCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDV 62

Query: 215 WRN------KLFVSVPRW 250
           +         +FV++PR+
Sbjct: 63  YYKHGDATPSIFVTIPRF 80


>AE013599-3590|AAF46993.1|  412|Drosophila melanogaster CG9891-PA
           protein.
          Length = 412

 Score = 32.3 bits (70), Expect = 0.46
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 8/78 (10%)
 Frame = +2

Query: 41  KFLVF--CGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIER 214
           +++VF  C    LA++   L+ +F    ++  +P    +Q+ALR G   P + +P+ ++ 
Sbjct: 3   RWIVFGVCCWCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDV 62

Query: 215 WRN------KLFVSVPRW 250
           +         +FV++PR+
Sbjct: 63  YYKHGDATPSIFVTIPRF 80


>U69607-1|AAD08845.1|  493|Drosophila melanogaster amylase-like
           protein protein.
          Length = 493

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -3

Query: 250 PPRNADEQFVPPPFDTNGQCV 188
           PPR+A E+ + P FD +G CV
Sbjct: 356 PPRDAQERIISPEFDADGACV 376


>AE014296-437|AAF47631.1|  393|Drosophila melanogaster CG5717-PA
           protein.
          Length = 393

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+P TL  + L    E   K+ PYP +   E GNCQ  L +V  +  DQ
Sbjct: 100 GVPFTLGKVNLKKG-ECLTKIAPYPCWAIQEEGNCQ-ALQSVVDIAVDQ 146



 Score = 27.9 bits (59), Expect = 9.8
 Identities = 10/42 (23%), Positives = 25/42 (59%)
 Frame = +2

Query: 128 NYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           ++P + +K   +++G  +P N +    +  R+  FV++PR++
Sbjct: 57  HWPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYK 98


>AY052055-1|AAK93479.1|  493|Drosophila melanogaster LP08070p
           protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -3

Query: 250 PPRNADEQFVPPPFDTNGQCV 188
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


>AF022713-3|AAD09147.2|  493|Drosophila melanogaster putative
           amylase-related protein protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -3

Query: 250 PPRNADEQFVPPPFDTNGQCV 188
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


>AE013599-2321|AAF57971.1|  493|Drosophila melanogaster CG8221-PA
           protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -3

Query: 250 PPRNADEQFVPPPFDTNGQCV 188
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


>AY118746-1|AAM50606.1|  739|Drosophila melanogaster GH05829p
           protein.
          Length = 739

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/32 (43%), Positives = 15/32 (46%)
 Frame = -3

Query: 280 CSSK*LGYLAPPRNADEQFVPPPFDTNGQCVL 185
           C    L Y  P RN D Q +PPP    G  VL
Sbjct: 226 CERGALTYTNPKRNVDTQTIPPPRSQFGANVL 257


>AE014296-438|AAF47632.1|  382|Drosophila melanogaster CG13804-PA
           protein.
          Length = 382

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PATL    +  P   S    PYP ++  E GNC+  L +V  +  DQ
Sbjct: 90  GVPATLVKTSIK-PGTCSTTFKPYPCWDLQEEGNCK-ALQSVVDLVVDQ 136


>AE013599-3094|AAF46647.5|  739|Drosophila melanogaster CG9313-PA
           protein.
          Length = 739

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/32 (43%), Positives = 15/32 (46%)
 Frame = -3

Query: 280 CSSK*LGYLAPPRNADEQFVPPPFDTNGQCVL 185
           C    L Y  P RN D Q +PPP    G  VL
Sbjct: 226 CERGALTYTNPKRNVDTQTIPPPRSQFGANVL 257


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,193,451
Number of Sequences: 53049
Number of extensions: 577724
Number of successful extensions: 1475
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1404
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1469
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2151905496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).