SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0030
         (704 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY128474-1|AAM75067.1| 1113|Drosophila melanogaster RE32455p pro...    29   8.1  
AY051434-1|AAK92858.1|  955|Drosophila melanogaster GH10726p pro...    29   8.1  
AJ309488-1|CAC83725.1|  793|Drosophila melanogaster chitin synth...    29   8.1  
AF227729-1|AAG09735.1|  997|Drosophila melanogaster chitin synth...    29   8.1  
AE014297-241|AAG22215.2| 1674|Drosophila melanogaster CG2666-PB,...    29   8.1  
AE014297-240|AAS65101.1| 1615|Drosophila melanogaster CG2666-PC,...    29   8.1  
AE014297-239|AAN13280.1| 1615|Drosophila melanogaster CG2666-PA,...    29   8.1  

>AY128474-1|AAM75067.1| 1113|Drosophila melanogaster RE32455p protein.
          Length = 1113

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183  TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 941  SVFAFFMINALFVLIVFLLQLNKDNIHVKW 970


>AY051434-1|AAK92858.1|  955|Drosophila melanogaster GH10726p
           protein.
          Length = 955

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183 TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
           ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 627 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 656


>AJ309488-1|CAC83725.1|  793|Drosophila melanogaster chitin synthase
           B protein.
          Length = 793

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183 TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
           ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 465 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 494


>AF227729-1|AAG09735.1|  997|Drosophila melanogaster chitin synthase
           1 protein.
          Length = 997

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183 TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
           ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 669 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 698


>AE014297-241|AAG22215.2| 1674|Drosophila melanogaster CG2666-PB,
            isoform B protein.
          Length = 1674

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183  TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 1287 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 1316


>AE014297-240|AAS65101.1| 1615|Drosophila melanogaster CG2666-PC,
            isoform C protein.
          Length = 1615

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183  TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 1287 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 1316


>AE014297-239|AAN13280.1| 1615|Drosophila melanogaster CG2666-PA,
            isoform A protein.
          Length = 1615

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -3

Query: 183  TMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            ++F F ++N +FV   FL+Q  K NI VKW
Sbjct: 1287 SVFAFFMINALFVLIVFLLQLNKDNIHVKW 1316


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,875,058
Number of Sequences: 53049
Number of extensions: 552908
Number of successful extensions: 679
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 673
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 679
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3108380451
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).