SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF273708-1|AAL35411.1|  118|Drosophila melanogaster PFTAIRE-inte...    54   2e-07
AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA...    54   2e-07
BT025212-1|ABF17903.1| 1189|Drosophila melanogaster FI01101p pro...    37   0.020
AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH1064...    37   0.020
AE014298-1293|AAF46457.1| 1189|Drosophila melanogaster CG12218-P...    37   0.020
BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p pro...    36   0.046
AE014296-2946|AAF49313.1|  797|Drosophila melanogaster CG6064-PA...    36   0.046
AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA...    36   0.046
BT023016-1|AAY55432.1|  176|Drosophila melanogaster IP04080p pro...    35   0.080
AY069769-1|AAL39914.1| 1928|Drosophila melanogaster SD01229p pro...    35   0.080
AY069370-1|AAL39515.1|  863|Drosophila melanogaster LD07688p pro...    35   0.080
AE014297-2741|AAF55729.1|  863|Drosophila melanogaster CG12254-P...    35   0.080
BT025061-1|ABE73232.1|  388|Drosophila melanogaster IP15635p pro...    35   0.11 
AF217281-1|AAF27637.1| 1616|Drosophila melanogaster ecdysone-ind...    35   0.11 
AE014296-1440|AAF50429.2| 1616|Drosophila melanogaster CG32356-P...    35   0.11 
BT001258-1|AAN71014.1|  397|Drosophila melanogaster AT02070p pro...    34   0.18 
AY051454-1|AAK92878.1|  397|Drosophila melanogaster GH12043p pro...    34   0.18 
AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB...    34   0.18 
AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-P...    34   0.18 
AE013599-3144|AAM70856.1|  980|Drosophila melanogaster CG30389-P...    34   0.18 
AE013599-3143|AAF46685.2|  980|Drosophila melanogaster CG30389-P...    34   0.18 
X67703-3|CAA47939.1|   55|Drosophila melanogaster Mst84Dc protein.     33   0.24 
AY058413-1|AAL13642.1|  259|Drosophila melanogaster GH18971p pro...    33   0.24 
AE014298-786|AAF46075.1|  259|Drosophila melanogaster CG15772-PA...    33   0.24 
AE014297-605|AAF54025.1|   55|Drosophila melanogaster CG17945-PA...    33   0.24 
U42403-1|AAB02355.1| 1180|Drosophila melanogaster stripe a prote...    33   0.32 
U42402-1|AAB02354.1|  906|Drosophila melanogaster stripe b prote...    33   0.32 
AE014297-2438|AAN13756.1|  906|Drosophila melanogaster CG7847-PB...    33   0.32 
AE014297-2437|AAF55492.1| 1186|Drosophila melanogaster CG7847-PA...    33   0.32 
Z29361-1|CAA82545.1|  644|Drosophila melanogaster BTD protein.         32   0.56 
Z11743-1|CAA77802.1| 1403|Drosophila melanogaster prospero protein.    32   0.56 
M81389-1|AAA28841.1| 1407|Drosophila melanogaster Pros protein p...    32   0.56 
D10609-1|BAA01464.1| 1403|Drosophila melanogaster prospero protein.    32   0.56 
BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro...    32   0.56 
BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro...    32   0.56 
BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro...    32   0.56 
BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro...    32   0.56 
BT022161-1|AAY51555.1|  542|Drosophila melanogaster IP01358p pro...    32   0.56 
BT015263-1|AAT94492.1| 1374|Drosophila melanogaster LD37627p pro...    32   0.56 
BT003486-1|AAO39489.1|  414|Drosophila melanogaster SD17309p pro...    32   0.56 
AY084183-1|AAL89921.1|  315|Drosophila melanogaster RE62247p pro...    32   0.56 
AF395905-1|AAL59599.1|  943|Drosophila melanogaster rotund protein.    32   0.56 
AF395904-1|AAL59598.1|  692|Drosophila melanogaster roughened ey...    32   0.56 
AF247562-1|AAF70256.1| 2302|Drosophila melanogaster Scribbler lo...    32   0.56 
AF242194-1|AAF76322.1| 2302|Drosophila melanogaster brakeless-B ...    32   0.56 
AF190403-1|AAF05703.1| 1403|Drosophila melanogaster homeodomain ...    32   0.56 
AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791...    32   0.56 
AF069997-1|AAC62234.1| 1027|Drosophila melanogaster CLOCK protein.     32   0.56 
AF067207-1|AAD10630.1| 1023|Drosophila melanogaster CLOCK protein.     32   0.56 
AE014298-1363|AAF46518.1|  644|Drosophila melanogaster CG12653-P...    32   0.56 
AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD...    32   0.56 
AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC...    32   0.56 
AE014297-1287|AAN13500.2| 1374|Drosophila melanogaster CG17228-P...    32   0.56 
AE014297-1286|AAF54628.2| 1403|Drosophila melanogaster CG17228-P...    32   0.56 
AE014297-1285|AAN13501.2| 1535|Drosophila melanogaster CG17228-P...    32   0.56 
AE014297-594|AAS65102.1|  692|Drosophila melanogaster CG32466-PB...    32   0.56 
AE014297-593|AAF54032.3|  946|Drosophila melanogaster CG32466-PA...    32   0.56 
AE014296-1322|AAX52754.1|  961|Drosophila melanogaster CG7391-PF...    32   0.56 
AE014296-1321|AAX52753.1| 1027|Drosophila melanogaster CG7391-PD...    32   0.56 
AE014296-1320|AAS65057.1| 1027|Drosophila melanogaster CG7391-PC...    32   0.56 
AE014296-1319|AAN12019.1| 1023|Drosophila melanogaster CG7391-PB...    32   0.56 
AE014296-1318|AAF50516.1| 1023|Drosophila melanogaster CG7391-PA...    32   0.56 
AE013599-2653|AAF57721.1| 2280|Drosophila melanogaster CG5580-PA...    32   0.56 
AB044403-1|BAB20792.1| 2310|Drosophila melanogaster master of th...    32   0.56 
BT029401-1|ABK57058.1|   96|Drosophila melanogaster IP02163p pro...    32   0.74 
BT023344-1|AAY55760.1|   72|Drosophila melanogaster IP02161p pro...    32   0.74 
AF175223-1|AAD52614.1| 3469|Drosophila melanogaster SANT domain ...    32   0.74 
AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC...    32   0.74 
AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB...    32   0.74 
AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA...    32   0.74 
AE014297-604|AAF54026.1|   72|Drosophila melanogaster CG17935-PA...    32   0.74 
AE013599-3283|AAM71018.2| 2968|Drosophila melanogaster CG13492-P...    32   0.74 
AE013599-3282|AAF46766.2| 2931|Drosophila melanogaster CG13492-P...    32   0.74 
BT022160-1|AAY51554.1|  520|Drosophila melanogaster IP01388p pro...    31   0.98 
BT003186-1|AAO24941.1|  756|Drosophila melanogaster RE65015p pro...    31   0.98 
AY128472-1|AAM75065.1|  836|Drosophila melanogaster RE28238p pro...    31   0.98 
AY118393-1|AAM48422.1|  535|Drosophila melanogaster RE47124p pro...    31   0.98 
AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p pro...    31   0.98 
AY069721-1|AAL39866.1|  285|Drosophila melanogaster LP02658p pro...    31   0.98 
AF065133-1|AAC39101.1| 1015|Drosophila melanogaster CLOCK protein.     31   0.98 
AE014298-690|AAF45994.2|  543|Drosophila melanogaster CG32772-PA...    31   0.98 
AE014297-4674|AAO41616.1|  578|Drosophila melanogaster CG12071-P...    31   0.98 
AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-P...    31   0.98 
AE014296-1152|AAS65070.1| 1833|Drosophila melanogaster CG10107-P...    31   0.98 
AE014296-1151|AAF50646.3| 1833|Drosophila melanogaster CG10107-P...    31   0.98 
AE014134-2320|AAN10833.1|  836|Drosophila melanogaster CG6043-PC...    31   0.98 
AE014134-2318|AAN10831.1|  759|Drosophila melanogaster CG6043-PB...    31   0.98 
AE014134-2317|AAF53274.2|  759|Drosophila melanogaster CG6043-PA...    31   0.98 
AE014134-2316|AAN10830.1|  918|Drosophila melanogaster CG6043-PD...    31   0.98 
BT024280-1|ABC86342.1| 1129|Drosophila melanogaster IP14311p pro...    31   1.3  
AY119105-1|AAM50965.1|  259|Drosophila melanogaster RE07996p pro...    31   1.3  
AE014298-938|AAF46192.1| 1125|Drosophila melanogaster CG14441-PA...    31   1.3  
AE014296-1939|AAF50073.2|  558|Drosophila melanogaster CG6175-PB...    31   1.3  
AE013599-2063|AAF58133.2| 1135|Drosophila melanogaster CG12964-P...    31   1.3  
X51549-1|CAA35924.1| 1394|Drosophila melanogaster protein ( Dros...    31   1.7  
M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein.         31   1.7  
BT029664-1|ABL75722.1|  294|Drosophila melanogaster IP17310p pro...    31   1.7  
BT028816-1|ABI34197.1|  482|Drosophila melanogaster RT01022p pro...    31   1.7  
BT021311-1|AAX33459.1|  523|Drosophila melanogaster RE14763p pro...    31   1.7  
BT016125-1|AAV37010.1|  500|Drosophila melanogaster GM16860p pro...    31   1.7  
AY113276-1|AAM29281.1|  120|Drosophila melanogaster AT17606p pro...    31   1.7  
AE014296-2991|AAN11688.1| 1355|Drosophila melanogaster CG8127-PA...    31   1.7  
AE014134-793|AAF50966.2|  510|Drosophila melanogaster CG11924-PA...    31   1.7  
AE014134-792|AAO41153.1|  482|Drosophila melanogaster CG11924-PC...    31   1.7  
AE014134-791|AAO41152.1|  482|Drosophila melanogaster CG11924-PB...    31   1.7  
AE014134-790|AAO41151.1|  514|Drosophila melanogaster CG11924-PD...    31   1.7  
AE013599-3295|AAF46776.2|  120|Drosophila melanogaster CG13494-P...    31   1.7  
D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked p...    30   2.3  
BT030438-1|ABO52858.1|  520|Drosophila melanogaster IP18557p pro...    30   2.3  
BT029042-1|ABJ16975.1|  128|Drosophila melanogaster IP04527p pro...    30   2.3  
AY060380-1|AAL25419.1| 1202|Drosophila melanogaster LD27118p pro...    30   2.3  
AJ131022-1|CAB55429.1|  523|Drosophila melanogaster C2H2 zinc fi...    30   2.3  
AF018078-1|AAB70303.1|  654|Drosophila melanogaster unknown prot...    30   2.3  
AE014298-2553|AAO41690.1| 1509|Drosophila melanogaster CG5424-PC...    30   2.3  
AE014298-2552|AAO41689.1| 1436|Drosophila melanogaster CG5424-PD...    30   2.3  
AE014298-2551|AAF48718.2| 1436|Drosophila melanogaster CG5424-PB...    30   2.3  
AE014298-2550|ABI30989.1| 1918|Drosophila melanogaster CG5424-PF...    30   2.3  
AE014298-1365|AAN09612.1|  520|Drosophila melanogaster CG1343-PB...    30   2.3  
AE014298-1364|AAF46519.2|  691|Drosophila melanogaster CG1343-PA...    30   2.3  
AE014296-2342|AAF49773.3| 3146|Drosophila melanogaster CG9007-PA...    30   2.3  
AE013599-3137|AAF46678.2| 1202|Drosophila melanogaster CG30388-P...    30   2.3  
AE013599-869|AAF58935.1|  254|Drosophila melanogaster CG13953-PA...    30   2.3  
BT030423-1|ABO52843.1|  506|Drosophila melanogaster IP17710p pro...    30   3.0  
BT030127-1|ABN49266.1|  233|Drosophila melanogaster IP14886p pro...    30   3.0  
BT023765-1|AAZ41773.1|  701|Drosophila melanogaster RE18252p pro...    30   3.0  
BT015224-1|AAT94453.1|  697|Drosophila melanogaster RE33368p pro...    30   3.0  
BT001611-1|AAN71366.1|  697|Drosophila melanogaster RE32656p pro...    30   3.0  
BT001532-1|AAN71287.1|  411|Drosophila melanogaster RE06837p pro...    30   3.0  
AY070526-1|AAL47997.1|  647|Drosophila melanogaster GH27708p pro...    30   3.0  
AY058369-1|AAL13598.1|  389|Drosophila melanogaster GH13848p pro...    30   3.0  
AY051994-1|AAK93418.1|  736|Drosophila melanogaster LD46233p pro...    30   3.0  
AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L lon...    30   3.0  
AF173847-1|AAD48878.1|  535|Drosophila melanogaster Zn finger tr...    30   3.0  
AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA...    30   3.0  
AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB...    30   3.0  
AE014298-1322|AAF46483.1|  663|Drosophila melanogaster CG17446-P...    30   3.0  
AE014297-3614|AAN14015.2|  697|Drosophila melanogaster CG13627-P...    30   3.0  
AE014297-3613|AAF56325.1|  697|Drosophila melanogaster CG13627-P...    30   3.0  
AE014297-2637|AAF55644.2|  535|Drosophila melanogaster CG5557-PA...    30   3.0  
AE014297-1770|AAF54997.1|  524|Drosophila melanogaster CG9930-PA...    30   3.0  
AE014296-1332|AAN12025.1|  647|Drosophila melanogaster CG17888-P...    30   3.0  
AE014296-762|AAN11585.1|  389|Drosophila melanogaster CG14995-PB...    30   3.0  
AE014296-761|AAF47837.1|  454|Drosophila melanogaster CG14995-PA...    30   3.0  
AE014296-760|AAN11584.1|  411|Drosophila melanogaster CG14995-PC...    30   3.0  
AE014296-759|AAN11583.1|  354|Drosophila melanogaster CG14995-PD...    30   3.0  
AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA ...    30   3.0  
AE014134-2732|AAN10947.1|  701|Drosophila melanogaster CG5953-PB...    30   3.0  
AE014134-2731|AAF53541.2|  701|Drosophila melanogaster CG5953-PA...    30   3.0  
AE014134-1945|AAF53004.2|  736|Drosophila melanogaster CG12299-P...    30   3.0  
AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA, ...    30   3.0  
Y16899-1|CAA76529.1|  712|Drosophila melanogaster optomotor-blin...    29   4.0  
X77532-1|CAA54670.1|  450|Drosophila melanogaster serum response...    29   4.0  
BT030119-1|ABN49258.1|  152|Drosophila melanogaster IP12727p pro...    29   4.0  
BT025148-1|ABE73318.1|  270|Drosophila melanogaster IP04354p pro...    29   4.0  
BT025086-1|ABE73257.1| 1024|Drosophila melanogaster IP14647p pro...    29   4.0  
BT012496-1|AAS93767.1|  421|Drosophila melanogaster HL01444p pro...    29   4.0  
BT010118-1|AAQ22587.1|  961|Drosophila melanogaster AT27581p pro...    29   4.0  
BT003612-1|AAO39615.1|  521|Drosophila melanogaster GH15792p pro...    29   4.0  
BT003320-1|AAO25080.1|  798|Drosophila melanogaster AT11823p pro...    29   4.0  
AY095071-1|AAM11399.1|  449|Drosophila melanogaster RE17834p pro...    29   4.0  
AY070840-1|AAL48462.1|  790|Drosophila melanogaster GH21062p pro...    29   4.0  
AY069327-1|AAL39472.2|  552|Drosophila melanogaster LD04591p pro...    29   4.0  
AY060624-1|AAL28172.1|  505|Drosophila melanogaster GH04632p pro...    29   4.0  
AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends l...    29   4.0  
AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP mot...    29   4.0  
AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends p...    29   4.0  
AE014298-1177|AAF46373.1|  699|Drosophila melanogaster CG11202-P...    29   4.0  
AE014298-574|ABC67172.1| 1059|Drosophila melanogaster CG32776-PD...    29   4.0  
AE014298-573|AAS72338.2| 1058|Drosophila melanogaster CG32776-PB...    29   4.0  
AE014297-4076|AAF56673.2|  980|Drosophila melanogaster CG6051-PA...    29   4.0  
AE014297-1059|AAF54468.3|  521|Drosophila melanogaster CG33975-P...    29   4.0  
AE014296-877|AAF47920.2|  505|Drosophila melanogaster CG32245-PB...    29   4.0  
AE014296-690|AAF47788.2|  790|Drosophila melanogaster CG32264-PB...    29   4.0  
AE014296-611|AAS64955.1|  958|Drosophila melanogaster CG11505-PC...    29   4.0  
AE014296-610|AAF47745.1| 1521|Drosophila melanogaster CG11505-PA...    29   4.0  
AE014296-609|AAG22237.2| 1531|Drosophila melanogaster CG11505-PB...    29   4.0  
AE014134-2438|AAN10861.1|  421|Drosophila melanogaster CG31839-P...    29   4.0  
AE014134-908|AAF52239.3| 2267|Drosophila melanogaster CG14023-PA...    29   4.0  
AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,...    29   4.0  
AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,...    29   4.0  
AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,...    29   4.0  
AE013599-3853|AAF47195.1|  449|Drosophila melanogaster CG3411-PA...    29   4.0  
AE013599-3368|AAF46827.1| 1024|Drosophila melanogaster CG5799-PA...    29   4.0  
Z50097-2|CAB58233.1| 1080|Drosophila melanogaster headcase prote...    29   5.2  
X59772-1|CAB36921.1|  850|Drosophila melanogaster ovo protein pr...    29   5.2  
U33015-1|AAB38385.1|  454|Drosophila melanogaster Cdk8 protein.        29   5.2  
U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro...    29   5.2  
BT022385-1|AAY54801.1|  124|Drosophila melanogaster IP05263p pro...    29   5.2  
BT022159-1|AAY51785.1| 1224|Drosophila melanogaster IP01381p pro...    29   5.2  
BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p pro...    29   5.2  
BT009981-1|AAQ22450.1| 1281|Drosophila melanogaster RE54443p pro...    29   5.2  
AY119649-1|AAM50303.1|  975|Drosophila melanogaster RE46053p pro...    29   5.2  
AY119554-1|AAM50208.1| 1054|Drosophila melanogaster GH28348p pro...    29   5.2  
AY119111-1|AAM50971.1|  454|Drosophila melanogaster RE13344p pro...    29   5.2  
AY118284-1|AAM48313.1|  630|Drosophila melanogaster AT15314p pro...    29   5.2  
AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro...    29   5.2  
AY089493-1|AAL90231.1|  734|Drosophila melanogaster GH05993p pro...    29   5.2  
AY060753-1|AAL28301.1|  271|Drosophila melanogaster GH20409p pro...    29   5.2  
AY058706-1|AAL13935.1| 1556|Drosophila melanogaster LD43050p pro...    29   5.2  
AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein...    29   5.2  
AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p...    29   5.2  
AF088274-1|AAD39717.1|  103|Drosophila melanogaster Suppressor o...    29   5.2  
AE014298-2605|AAF48759.2| 1556|Drosophila melanogaster CG32560-P...    29   5.2  
AE014298-704|AAS65261.1| 1281|Drosophila melanogaster CG32767-PB...    29   5.2  
AE014298-703|AAF46005.2| 1281|Drosophila melanogaster CG32767-PA...    29   5.2  
AE014298-702|AAF46002.2|  975|Drosophila melanogaster CG6824-PA,...    29   5.2  
AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,...    29   5.2  
AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,...    29   5.2  
AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,...    29   5.2  
AE014297-4575|AAO41615.1| 1080|Drosophila melanogaster CG15532-P...    29   5.2  
AE014297-3885|AAF56538.1|  613|Drosophila melanogaster CG14540-P...    29   5.2  
AE014297-2619|AAF55629.2| 1542|Drosophila melanogaster CG6026-PA...    29   5.2  
AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA...    29   5.2  
AE014297-95|AAF52123.1|  970|Drosophila melanogaster CG14650-PA ...    29   5.2  
AE014296-3573|AAF51744.3| 2352|Drosophila melanogaster CG7177-PA...    29   5.2  
AE014296-1760|AAF50197.2|  454|Drosophila melanogaster CG10572-P...    29   5.2  
AE014296-1713|AAF50220.2| 1473|Drosophila melanogaster CG16711-P...    29   5.2  
AE014134-1654|AAF52786.2| 1054|Drosophila melanogaster CG4405-PB...    29   5.2  
AE014134-1653|AAF52787.2| 1054|Drosophila melanogaster CG4405-PA...    29   5.2  
AE014134-406|AAF51257.1|  271|Drosophila melanogaster CG3557-PA ...    29   5.2  
AB069908-1|BAB62875.1| 1054|Drosophila melanogaster junctophilin...    29   5.2  
X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protei...    29   6.9  
BT029620-1|ABL75679.1|  127|Drosophila melanogaster IP17106p pro...    29   6.9  
BT029556-1|ABL75616.1|  127|Drosophila melanogaster IP16806p pro...    29   6.9  
BT022130-1|AAY51525.1|  530|Drosophila melanogaster IP08855p pro...    29   6.9  
AY971884-1|AAX73355.1| 1518|Drosophila melanogaster hormone rece...    29   6.9  
AY484701-1|AAR85347.1|  881|Drosophila melanogaster dysfusion pr...    29   6.9  
AY089604-1|AAL90342.1|  742|Drosophila melanogaster RE19838p pro...    29   6.9  
AL035245-2|CAA22836.1| 1464|Drosophila melanogaster EG:133E12.2 ...    29   6.9  
AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA...    29   6.9  
AE014298-1329|AAF46491.3| 1367|Drosophila melanogaster CG32705-P...    29   6.9  
AE014298-306|ABC67166.1| 1518|Drosophila melanogaster CG16902-PC...    29   6.9  
AE014297-3920|AAF56569.3|  881|Drosophila melanogaster CG32474-P...    29   6.9  
AE014296-2419|AAS65007.1|  582|Drosophila melanogaster CG33261-P...    29   6.9  
AE014296-2418|AAF49709.1|  582|Drosophila melanogaster CG33261-P...    29   6.9  
AE014296-2417|ABC66143.1|  567|Drosophila melanogaster CG33261-P...    29   6.9  
AE014296-1982|AAF50042.1|  530|Drosophila melanogaster CG7368-PB...    29   6.9  
AE013599-2611|AAF57754.1| 1205|Drosophila melanogaster CG5756-PA...    29   6.9  
AE013599-2610|AAM68174.2|  742|Drosophila melanogaster CG5756-PB...    29   6.9  
AB095028-1|BAE53416.1|  918|Drosophila melanogaster bHLH-PAS pro...    29   6.9  
X67703-4|CAA47940.1|   68|Drosophila melanogaster Mst84Dd protein.     28   9.1  
M97196-2|AAA28395.1|  304|Drosophila melanogaster DNA-binding pr...    28   9.1  
M97196-1|AAA28396.1|  510|Drosophila melanogaster DNA-binding pr...    28   9.1  
BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro...    28   9.1  
BT010315-1|AAQ23633.1| 1559|Drosophila melanogaster AT27514p pro...    28   9.1  
BT001369-1|AAN71124.1|  347|Drosophila melanogaster AT30804p pro...    28   9.1  
AY094737-1|AAM11090.1|  828|Drosophila melanogaster GH28553p pro...    28   9.1  
AY058607-1|AAL13836.1|  999|Drosophila melanogaster LD30037p pro...    28   9.1  
AJ001164-1|CAA04568.1| 1668|Drosophila melanogaster Additional s...    28   9.1  
AF159852-1|AAD54965.1|  999|Drosophila melanogaster RNA-binding ...    28   9.1  
AF132213-1|AAF61321.1|  999|Drosophila melanogaster smaug protei...    28   9.1  
AE014298-1698|AAF48101.1| 1013|Drosophila melanogaster CG15740-P...    28   9.1  
AE014298-1259|AAF46433.1|  821|Drosophila melanogaster CG15365-P...    28   9.1  
AE014297-3729|AAF56407.3|  828|Drosophila melanogaster CG11848-P...    28   9.1  
AE014297-2532|AAN13775.1|  695|Drosophila melanogaster CG14307-P...    28   9.1  
AE014297-2531|AAS65172.1|  705|Drosophila melanogaster CG14307-P...    28   9.1  
AE014297-2530|AAF55563.2|  796|Drosophila melanogaster CG14307-P...    28   9.1  
AE014296-1651|AAF50277.2|  349|Drosophila melanogaster CG3982-PA...    28   9.1  
AE014296-1566|AAN11981.1|  999|Drosophila melanogaster CG5263-PC...    28   9.1  
AE014296-1565|AAF50334.3|  999|Drosophila melanogaster CG5263-PB...    28   9.1  
AE014296-1564|AAF50333.3|  999|Drosophila melanogaster CG5263-PA...    28   9.1  
AE013599-1903|AAX52705.1| 1560|Drosophila melanogaster CG8787-PB...    28   9.1  
AE013599-1902|AAF58239.1| 1669|Drosophila melanogaster CG8787-PA...    28   9.1  
AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB...    28   9.1  
AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA...    28   9.1  

>AF273708-1|AAL35411.1|  118|Drosophila melanogaster
           PFTAIRE-interacting factor 2 protein.
          Length = 118

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 7/90 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC--CFAILCWCCSNPASGSLHSPC--S 421
           C   CCS  C+  C  CC++ CG+ C P  G  C  C    C  C +P      +PC   
Sbjct: 9   CCGPCCSPCCSPCCPPCCNDCCGSCCSPCCGPCCSPCCGPCCSPCCSPCCTPCCTPCCTP 68

Query: 422 CCICCR---LPIWSSTSSTFPVWICTSVCS 502
           CC CC    +P  +   +      CT  CS
Sbjct: 69  CCKCCTPCCVPCCTPCCTPCCTPCCTPCCS 98



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/63 (39%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSN--RCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S CCS  CT  CT CC+   +C T CC      CC      CC+ P       PC C 
Sbjct: 49  CCSPCCSPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCT-PCCSPCCGPC-CS 106

Query: 428 ICC 436
            CC
Sbjct: 107 PCC 109



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/62 (40%), Positives = 26/62 (41%), Gaps = 2/62 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S CC+  CT  CT CC     C   CC      CC      CCS P  G   SPC C 
Sbjct: 53  CCSPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCS-PCCGPCCSPC-CS 110

Query: 428 IC 433
            C
Sbjct: 111 PC 112



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 26/59 (44%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           S CC   C   C+ CCS  C   CC      CC +  C  C +P  G   SPC C  CC
Sbjct: 3   SPCCGSCCGPCCSPCCS-PCCPPCCNDCCGSCC-SPCCGPCCSPCCGPCCSPC-CSPCC 58



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/58 (37%), Positives = 24/58 (41%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGS 403
           P   P   C + CC   CT  CT CC+  C   C P     CC      CCS P  GS
Sbjct: 64  PCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCSP-----CCGPCCSPCCS-PCGGS 115



 Score = 35.5 bits (78), Expect = 0.060
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC 355
           C + CC+  CT  C+ CC   C   C P  G  C
Sbjct: 84  CCTPCCTPCCTPCCSPCCGPCCSPCCSPCGGSKC 117


>AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA
           protein.
          Length = 118

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 7/90 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC--CFAILCWCCSNPASGSLHSPC--S 421
           C   CCS  C+  C  CC++ CG+ C P  G  C  C    C  C +P      +PC   
Sbjct: 9   CCGPCCSPCCSPCCPPCCNDCCGSCCSPCCGPCCSPCCGPCCSPCCSPCCTPCCTPCCTP 68

Query: 422 CCICCR---LPIWSSTSSTFPVWICTSVCS 502
           CC CC    +P  +   +      CT  CS
Sbjct: 69  CCKCCTPCCVPCCTPCCTPCCTPCCTPCCS 98



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/63 (39%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSN--RCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S CCS  CT  CT CC+   +C T CC      CC      CC+ P       PC C 
Sbjct: 49  CCSPCCSPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCT-PCCSPCCGPC-CS 106

Query: 428 ICC 436
            CC
Sbjct: 107 PCC 109



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/62 (40%), Positives = 26/62 (41%), Gaps = 2/62 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S CC+  CT  CT CC     C   CC      CC      CCS P  G   SPC C 
Sbjct: 53  CCSPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCS-PCCGPCCSPC-CS 110

Query: 428 IC 433
            C
Sbjct: 111 PC 112



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 26/59 (44%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           S CC   C   C+ CCS  C   CC      CC +  C  C +P  G   SPC C  CC
Sbjct: 3   SPCCGSCCGPCCSPCCS-PCCPPCCNDCCGSCC-SPCCGPCCSPCCGPCCSPC-CSPCC 58



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/58 (37%), Positives = 24/58 (41%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGS 403
           P   P   C + CC   CT  CT CC+  C   C P     CC      CCS P  GS
Sbjct: 64  PCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCSP-----CCGPCCSPCCS-PCGGS 115



 Score = 35.5 bits (78), Expect = 0.060
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC 355
           C + CC+  CT  C+ CC   C   C P  G  C
Sbjct: 84  CCTPCCTPCCTPCCSPCCGPCCSPCCSPCGGSKC 117


>BT025212-1|ABF17903.1| 1189|Drosophila melanogaster FI01101p
           protein.
          Length = 1189

 Score = 37.1 bits (82), Expect = 0.020
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +G  Q +QQ+Q + ++      QHQH + +Q       QQ+   +  QQ+ Q+++QL +Q
Sbjct: 536 LGMTQQLQQQQQQQQQLQQQQHQHQHQVQQQQHHHQQQQQQKQQVQHQQQ-QQKLQLQQQ 594

Query: 267 QMELH 253
           Q   H
Sbjct: 595 QQHQH 599



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G   ++      +Q +QQ+Q + +  +   +QH H   +Q +  +  QQ+   L  QQ+ 
Sbjct: 537 GMTQQLQQQQQQQQQLQQQQHQHQHQVQQ-QQHHHQQQQQQKQQVQHQQQQQKLQLQQQQ 595

Query: 294 QRRVQL*EQQMELHRGYGRSEGR 226
           Q +       +  HRG    +GR
Sbjct: 596 QHQHNS-NNLIVGHRGSSSVQGR 617


>AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH10646
           protein.
          Length = 1189

 Score = 37.1 bits (82), Expect = 0.020
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +G  Q +QQ+Q + ++      QHQH + +Q       QQ+   +  QQ+ Q+++QL +Q
Sbjct: 536 LGMTQQLQQQQQQQQQLQQQQHQHQHQVQQQQHHHQQQQQQKQQVQHQQQ-QQKLQLQQQ 594

Query: 267 QMELH 253
           Q   H
Sbjct: 595 QQHQH 599



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G   ++      +Q +QQ+Q + +  +   +QH H   +Q +  +  QQ+   L  QQ+ 
Sbjct: 537 GMTQQLQQQQQQQQQLQQQQHQHQHQVQQ-QQHHHQQQQQQKQQVQHQQQQQKLQLQQQQ 595

Query: 294 QRRVQL*EQQMELHRGYGRSEGR 226
           Q +       +  HRG    +GR
Sbjct: 596 QHQHNS-NNLIVGHRGSSSVQGR 617


>AE014298-1293|AAF46457.1| 1189|Drosophila melanogaster CG12218-PA
           protein.
          Length = 1189

 Score = 37.1 bits (82), Expect = 0.020
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +G  Q +QQ+Q + ++      QHQH + +Q       QQ+   +  QQ+ Q+++QL +Q
Sbjct: 536 LGMTQQLQQQQQQQQQLQQQQHQHQHQVQQQQHHHQQQQQQKQQVQHQQQ-QQKLQLQQQ 594

Query: 267 QMELH 253
           Q   H
Sbjct: 595 QQHQH 599



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G   ++      +Q +QQ+Q + +  +   +QH H   +Q +  +  QQ+   L  QQ+ 
Sbjct: 537 GMTQQLQQQQQQQQQLQQQQHQHQHQVQQ-QQHHHQQQQQQKQQVQHQQQQQKLQLQQQQ 595

Query: 294 QRRVQL*EQQMELHRGYGRSEGR 226
           Q +       +  HRG    +GR
Sbjct: 596 QHQHNS-NNLIVGHRGSSSVQGR 617


>BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p
           protein.
          Length = 1057

 Score = 35.9 bits (79), Expect = 0.046
 Identities = 17/66 (25%), Positives = 31/66 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH QQ+Q + ++    +  HQH      +     Q +  H  +Q + Q++ Q  +QQ +
Sbjct: 65  QQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQQQQQ 124

Query: 258 LHRGYG 241
            H   G
Sbjct: 125 QHPTIG 130



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           H   +QHMQQ+Q + ++     +Q QH   +QH+     QQ+ P
Sbjct: 85  HQHQQQHMQQQQQQ-QQHQQQHQQQQHQQQQQHQQQQQQQQQHP 127


>AE014296-2946|AAF49313.1|  797|Drosophila melanogaster CG6064-PA
           protein.
          Length = 797

 Score = 35.9 bits (79), Expect = 0.046
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -1

Query: 540 SLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQ-GECRE--PLAGLEQHQH 370
           SL R++    +  +  LV     +V  +  +   +QH QQ+Q G+ R   P  G+ +   
Sbjct: 150 SLWRRSSSDSALHQSALVAGFNSDVNSMGANYQQQQHQQQQQPGQPRSHSPHHGINRTMS 209

Query: 369 SMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
             A++ + PLL     PH L+ Q++Q++ Q  + Q +LH+
Sbjct: 210 PQAQRRKSPLLQ----PHQLQLQQLQQQQQQMQHQHQLHQ 245


>AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA
           protein.
          Length = 1039

 Score = 35.9 bits (79), Expect = 0.046
 Identities = 17/66 (25%), Positives = 31/66 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH QQ+Q + ++    +  HQH      +     Q +  H  +Q + Q++ Q  +QQ +
Sbjct: 65  QQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQQQQQ 124

Query: 258 LHRGYG 241
            H   G
Sbjct: 125 QHPTIG 130



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           H   +QHMQQ+Q + ++     +Q QH   +QH+     QQ+ P
Sbjct: 85  HQHQQQHMQQQQQQ-QQHQQQHQQQQHQQQQQHQQQQQQQQQHP 127


>BT023016-1|AAY55432.1|  176|Drosophila melanogaster IP04080p
           protein.
          Length = 176

 Score = 35.1 bits (77), Expect = 0.080
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 8/40 (20%)
 Frame = +2

Query: 260 SICCSYSCTLRCT----FCCSN----RCGTSCCPSSGILC 355
           SICCS+   LRC+     CC+     RC T  CPS+  LC
Sbjct: 123 SICCSHCHPLRCSVRPSLCCARFGQIRCSTGLCPSTFELC 162


>AY069769-1|AAL39914.1| 1928|Drosophila melanogaster SD01229p protein.
          Length = 1928

 Score = 35.1 bits (77), Expect = 0.080
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
 Frame = -1

Query: 480  HTGNVLEVLDHMGSRQHMQQEQGE----CREPLAGLEQHQHSMAKQHRMPLLGQQEVPHL 313
            H G + +    MGS Q  QQ+Q +     ++    ++QH   + +QH+     QQ+  H 
Sbjct: 1512 HPGMMHKDEPGMGSAQQQQQQQQQQMQIAQQQQQAIQQHHQHLQQQHQAQ-QQQQQQQHQ 1570

Query: 312  LEQQKVQRRVQL*EQQMELHRGYGRSE 232
             +QQ+ Q++ Q  +QQ +  +   +S+
Sbjct: 1571 QQQQQQQQQQQQQQQQQQQQQKLKQSQ 1597


>AY069370-1|AAL39515.1|  863|Drosophila melanogaster LD07688p
           protein.
          Length = 863

 Score = 35.1 bits (77), Expect = 0.080
 Identities = 21/65 (32%), Positives = 37/65 (56%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S Q  QQ+Q + ++     +Q Q    +Q RM +L QQ+   +L  Q++Q++ QL +QQ 
Sbjct: 404 SLQQQQQQQAQQQQQ----QQQQAQQQQQQRMQMLSQQQ---MLNHQQLQQQQQLAQQQQ 456

Query: 261 ELHRG 247
           +  +G
Sbjct: 457 QQQQG 461


>AE014297-2741|AAF55729.1|  863|Drosophila melanogaster CG12254-PA
           protein.
          Length = 863

 Score = 35.1 bits (77), Expect = 0.080
 Identities = 21/65 (32%), Positives = 37/65 (56%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S Q  QQ+Q + ++     +Q Q    +Q RM +L QQ+   +L  Q++Q++ QL +QQ 
Sbjct: 404 SLQQQQQQQAQQQQQ----QQQQAQQQQQQRMQMLSQQQ---MLNHQQLQQQQQLAQQQQ 456

Query: 261 ELHRG 247
           +  +G
Sbjct: 457 QQQQG 461


>BT025061-1|ABE73232.1|  388|Drosophila melanogaster IP15635p
           protein.
          Length = 388

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 24/105 (22%), Positives = 44/105 (41%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           + +   +V++  G  LE +D       + Q+Q +  E     E+ +H   +QHR+     
Sbjct: 276 TKLRPEVVEVDNGEKLEAVDLAHEETELTQQQNQLDEQQHQEEEQKHQEEEQHRIEQQQN 335

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
           QE     EQQ+ Q + Q+ +Q  +        +     Q+   PA
Sbjct: 336 QEE----EQQQQQHQQQVIDQASDAELPQSSQDATTGVQQLLTPA 376


>AF217281-1|AAF27637.1| 1616|Drosophila melanogaster
           ecdysone-inducible gene E1 protein.
          Length = 1616

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 24/105 (22%), Positives = 44/105 (41%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           + +   +V++  G  LE +D       + Q+Q +  E     E+ +H   +QHR+     
Sbjct: 276 TKLRPEVVEVDNGEKLEAVDLAHEETELTQQQNQLDEQQHQEEEQKHQEEEQHRIEQQQN 335

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
           QE     EQQ+ Q + Q+ +Q  +        +     Q+   PA
Sbjct: 336 QEE----EQQQQQHQQQVIDQASDAELPQSSQDATTGVQQLLTPA 376


>AE014296-1440|AAF50429.2| 1616|Drosophila melanogaster CG32356-PA,
           isoform A protein.
          Length = 1616

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 24/105 (22%), Positives = 44/105 (41%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           + +   +V++  G  LE +D       + Q+Q +  E     E+ +H   +QHR+     
Sbjct: 276 TKLRPEVVEVDNGEKLEAVDLAHEETELTQQQNQLDEQQHQEEEQKHQEEEQHRIEQQQN 335

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
           QE     EQQ+ Q + Q+ +Q  +        +     Q+   PA
Sbjct: 336 QEE----EQQQQQHQQQVIDQASDAELPQSSQDATTGVQQLLTPA 376


>BT001258-1|AAN71014.1|  397|Drosophila melanogaster AT02070p
           protein.
          Length = 397

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           E   H   +QH Q +Q +  +     +Q QH   +QH+     QQ   H   QQ  Q + 
Sbjct: 264 EYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQHQQHQQHQQHQQ 323

Query: 282 Q 280
           Q
Sbjct: 324 Q 324



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q +Q +  +     +QHQ    +QH+     QQ+  H  + Q+ Q+  Q  + Q +
Sbjct: 266 QQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQ-QHQQQHQQHQQHQQHQQHQQQ 324

Query: 258 LHRGYGRSE 232
              G G  +
Sbjct: 325 GGGGPGSQQ 333


>AY051454-1|AAK92878.1|  397|Drosophila melanogaster GH12043p
           protein.
          Length = 397

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           E   H   +QH Q +Q +  +     +Q QH   +QH+     QQ   H   QQ  Q + 
Sbjct: 264 EYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQHQQHQQHQQHQQ 323

Query: 282 Q 280
           Q
Sbjct: 324 Q 324



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q +Q +  +     +QHQ    +QH+     QQ+  H  + Q+ Q+  Q  + Q +
Sbjct: 266 QQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQ-QHQQQHQQHQQHQQHQQHQQQ 324

Query: 258 LHRGYGRSE 232
              G G  +
Sbjct: 325 GGGGPGSQQ 333


>AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB,
            isoform B protein.
          Length = 2038

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH QQ+Q +  +     +QHQ    +Q +   L QQ++    +QQ+ Q+ +Q  + Q +
Sbjct: 1509 QQHHQQQQQQTHQQQ---QQHQQQHHQQQQQQQLTQQQLQQQQQQQQQQQHLQQQQHQQQ 1565

Query: 258  LHR 250
             H+
Sbjct: 1566 HHQ 1568



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            LD   S Q  Q +Q + ++     +Q Q    +Q       QQ+    L QQ++Q++ Q 
Sbjct: 1491 LDLEPSLQQQQMQQMQLQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQLQQQQQQ 1550

Query: 276  *EQQMELHR 250
             +QQ  L +
Sbjct: 1551 QQQQQHLQQ 1559



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -1

Query: 516  SFSSIEQTLVQIHTGNV-LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL 340
            SF  +E +L Q     + L+   H   +Q   Q+Q + ++     +Q Q    +Q +   
Sbjct: 1489 SFLDLEPSLQQQQMQQMQLQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQLQQQQ 1548

Query: 339  LGQQEVPHLLEQQKVQRRVQ 280
              QQ+  HL +QQ  Q+  Q
Sbjct: 1549 QQQQQQQHLQQQQHQQQHHQ 1568


>AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-PA
            protein.
          Length = 2294

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 17/65 (26%), Positives = 39/65 (60%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            L ++  +Q MQ++Q + ++     +Q Q    +Q +  L+GQQ+   L++QQ+  ++ Q+
Sbjct: 1150 LQYLQQQQLMQKQQQQQQQQ----QQQQQQQQQQQQQQLVGQQQQQILIQQQQTPQQQQI 1205

Query: 276  *EQQM 262
             +Q++
Sbjct: 1206 LQQKL 1210



 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L    QHQH M +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 201 QQATQQQQIQQQQQL----QHQHQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQ 255

Query: 258 LHR 250
            H+
Sbjct: 256 QHQ 258



 Score = 29.9 bits (64), Expect = 3.0
 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -1

Query: 435  QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
            Q  QQ++ + ++    +  +Q  ++   R+  L QQ++    +QQ+ Q++ Q  +QQ + 
Sbjct: 1121 QQQQQQRMQMQQQPQQIVVNQQILSDPQRLQYLQQQQLMQKQQQQQQQQQQQQQQQQQQQ 1180

Query: 255  HRG-YGRSEGRCCYQRTQCP 199
             +   G+ + +   Q+ Q P
Sbjct: 1181 QQQLVGQQQQQILIQQQQTP 1200



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  Q++Q   ++ +   +Q QH    Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 195 KQRTQKQQATQQQQIQQQQQLQHQHQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 254


>AE013599-3144|AAM70856.1|  980|Drosophila melanogaster CG30389-PC,
            isoform C protein.
          Length = 980

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            E   H   +QH Q +Q +  +     +Q QH   +QH+     QQ   H   QQ  Q + 
Sbjct: 847  EYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQHQQHQQHQQHQQ 906

Query: 282  Q 280
            Q
Sbjct: 907  Q 907



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH Q +Q +  +     +QHQ    +QH+     QQ+  H  + Q+ Q+  Q  + Q +
Sbjct: 849  QQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQ-QHQQQHQQHQQHQQHQQHQQQ 907

Query: 258  LHRGYGRSE 232
               G G  +
Sbjct: 908  GGGGPGSQQ 916


>AE013599-3143|AAF46685.2|  980|Drosophila melanogaster CG30389-PA,
            isoform A protein.
          Length = 980

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            E   H   +QH Q +Q +  +     +Q QH   +QH+     QQ   H   QQ  Q + 
Sbjct: 847  EYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQHQQHQQHQQHQQ 906

Query: 282  Q 280
            Q
Sbjct: 907  Q 907



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH Q +Q +  +     +QHQ    +QH+     QQ+  H  + Q+ Q+  Q  + Q +
Sbjct: 849  QQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQ-QHQQQHQQHQQHQQHQQHQQQ 907

Query: 258  LHRGYGRSE 232
               G G  +
Sbjct: 908  GGGGPGSQQ 916


>X67703-3|CAA47939.1|   55|Drosophila melanogaster Mst84Dc protein.
          Length = 55

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 23/60 (38%), Positives = 23/60 (38%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC Y C   C  CC   CG  C P     CC    C  C  P  G   S C  C C
Sbjct: 6   CGS-CCGYYC---CGPCC-GPCGPRCGPCGS--CCGP--CGPC-GPCCGPFGSCCGGCWC 55


>AY058413-1|AAL13642.1|  259|Drosophila melanogaster GH18971p
           protein.
          Length = 259

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH QQ+  + ++     +QHQ    +Q +     QQ+  HL +QQ  Q + Q  +QQ
Sbjct: 37  QQHQQQQHQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHLQQQQHHQLQQQQQQQQ 94



 Score = 31.9 bits (69), Expect = 0.74
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q   Q+Q   +      +QHQH   +Q  +    QQ+  H L+QQ+ Q++ Q   
Sbjct: 44  HQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHL----QQQQHHQLQQQQQQQQHQQLA 99

Query: 270 QQMEL 256
             M L
Sbjct: 100 SNMSL 104


>AE014298-786|AAF46075.1|  259|Drosophila melanogaster CG15772-PA
           protein.
          Length = 259

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH QQ+  + ++     +QHQ    +Q +     QQ+  HL +QQ  Q + Q  +QQ
Sbjct: 37  QQHQQQQHQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHLQQQQHHQLQQQQQQQQ 94



 Score = 31.9 bits (69), Expect = 0.74
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q   Q+Q   +      +QHQH   +Q  +    QQ+  H L+QQ+ Q++ Q   
Sbjct: 44  HQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHL----QQQQHHQLQQQQQQQQHQQLA 99

Query: 270 QQMEL 256
             M L
Sbjct: 100 SNMSL 104


>AE014297-605|AAF54025.1|   55|Drosophila melanogaster CG17945-PA
           protein.
          Length = 55

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 23/60 (38%), Positives = 23/60 (38%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC Y C   C  CC   CG  C P     CC    C  C  P  G   S C  C C
Sbjct: 6   CGS-CCGYYC---CGPCC-GPCGPRCGPCGS--CCGP--CGPC-GPCCGPFGSCCGGCWC 55


>U42403-1|AAB02355.1| 1180|Drosophila melanogaster stripe a protein
           protein.
          Length = 1180

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +Q  QQ+Q   ++PL   +Q QH   +QH      Q  + H   QQ+  +
Sbjct: 660 QQQQQQQQQHQQQPLHQQQQLQHQQQQQHHQQHYQQHAIQHQQSQQQASK 709


>U42402-1|AAB02354.1|  906|Drosophila melanogaster stripe b protein
           protein.
          Length = 906

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +Q  QQ+Q   ++PL   +Q QH   +QH      Q  + H   QQ+  +
Sbjct: 386 QQQQQQQQQHQQQPLHQQQQLQHQQQQQHHQQHYQQHAIQHQQSQQQASK 435


>AE014297-2438|AAN13756.1|  906|Drosophila melanogaster CG7847-PB,
           isoform B protein.
          Length = 906

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +Q  QQ+Q   ++PL   +Q QH   +QH      Q  + H   QQ+  +
Sbjct: 386 QQQQQQQQQHQQQPLHQQQQLQHQQQQQHHQQHYQQHAIQHQQSQQQASK 435


>AE014297-2437|AAF55492.1| 1186|Drosophila melanogaster CG7847-PA,
           isoform A protein.
          Length = 1186

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +Q  QQ+Q   ++PL   +Q QH   +QH      Q  + H   QQ+  +
Sbjct: 666 QQQQQQQQQHQQQPLHQQQQLQHQQQQQHHQQHYQQHAIQHQQSQQQASK 715


>Z29361-1|CAA82545.1|  644|Drosophila melanogaster BTD protein.
          Length = 644

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQ--HQHSMAKQHRMPL----LGQQEVPHLLEQQKVQRRVQ 280
           ++QH  Q+Q   +      +Q  H H    QH + L      QQ + HL +QQ+ Q++ Q
Sbjct: 13  AQQHQAQQQQHAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQ 72

Query: 279 L*EQQME 259
             +QQ +
Sbjct: 73  QQQQQQQ 79



 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQH-QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H   +QH QQ+Q       A    H  H  A+Q  M  L QQ+     +QQ+ Q++ Q  
Sbjct: 23  HAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQQQQQQQQQQQ 82

Query: 273 EQ-QMELH 253
           +Q Q + H
Sbjct: 83  QQPQQQQH 90


>Z11743-1|CAA77802.1| 1403|Drosophila melanogaster prospero protein.
          Length = 1403

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>M81389-1|AAA28841.1| 1407|Drosophila melanogaster Pros protein
           protein.
          Length = 1407

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>D10609-1|BAA01464.1| 1403|Drosophila melanogaster prospero protein.
          Length = 1403

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p
           protein.
          Length = 1378

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 289 HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 345

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 346 QQQHFHQ 352


>BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p
           protein.
          Length = 1196

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 107 HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 163

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 164 QQQHFHQ 170


>BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p
           protein.
          Length = 1255

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 55  HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 111

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 112 QQQHFHQ 118


>BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p
           protein.
          Length = 1373

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 173 HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 229

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 230 QQQHFHQ 236


>BT022161-1|AAY51555.1|  542|Drosophila melanogaster IP01358p
           protein.
          Length = 542

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N +EV+     +Q  QQ+Q + ++     + H H    QH +P   QQ VP   +QQ+ Q
Sbjct: 329 NAMEVMHQQQQQQQQQQQQQQQQQQQQQQQAHHHH--PQHGVP--PQQHVPPQQQQQQQQ 384

Query: 291 RR 286
           ++
Sbjct: 385 QQ 386


>BT015263-1|AAT94492.1| 1374|Drosophila melanogaster LD37627p
           protein.
          Length = 1374

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>BT003486-1|AAO39489.1|  414|Drosophila melanogaster SD17309p
           protein.
          Length = 414

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           EV  H    QH  Q+Q + ++  A  +QHQ S  + H+   + QQ+    L+QQ+
Sbjct: 139 EVEMHEQQVQHQVQQQ-QAQQQQAQQQQHQQSQQQGHQQHQVQQQQTHQQLQQQR 192



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = -1

Query: 513 FSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLG 334
           +S  EQ  V++H   V   +    ++Q   Q+Q   +    G +QHQ    + H+  L  
Sbjct: 132 YSEEEQREVEMHEQQVQHQVQQQQAQQQQAQQQQHQQSQQQGHQQHQVQQQQTHQQ-LQQ 190

Query: 333 QQEV 322
           Q++V
Sbjct: 191 QRDV 194


>AY084183-1|AAL89921.1|  315|Drosophila melanogaster RE62247p
           protein.
          Length = 315

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQ--HQHSMAKQHRMPL----LGQQEVPHLLEQQKVQRRVQ 280
           ++QH  Q+Q   +      +Q  H H    QH + L      QQ + HL +QQ+ Q++ Q
Sbjct: 13  AQQHQAQQQQHAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQ 72

Query: 279 L*EQQME 259
             +QQ +
Sbjct: 73  QQQQQQQ 79



 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQH-QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H   +QH QQ+Q       A    H  H  A+Q  M  L QQ+     +QQ+ Q++ Q  
Sbjct: 23  HAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQQQQQQQQQQQ 82

Query: 273 EQ-QMELH 253
           +Q Q + H
Sbjct: 83  QQPQQQQH 90


>AF395905-1|AAL59599.1|  943|Drosophila melanogaster rotund protein.
          Length = 943

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N +EV+     +Q  QQ+Q + ++     + H H    QH +P   QQ VP   +QQ+ Q
Sbjct: 730 NAMEVMHQQQQQQQQQQQQQQQQQQQQQQQAHHHH--PQHGVP--PQQHVPPQQQQQQQQ 785

Query: 291 RR 286
           ++
Sbjct: 786 QQ 787


>AF395904-1|AAL59598.1|  692|Drosophila melanogaster roughened eye
           protein.
          Length = 692

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N +EV+     +Q  QQ+Q + ++     + H H    QH +P   QQ VP   +QQ+ Q
Sbjct: 479 NAMEVMHQQQQQQQQQQQQQQQQQQQQQQQAHHHH--PQHGVP--PQQHVPPQQQQQQQQ 534

Query: 291 RR 286
           ++
Sbjct: 535 QQ 536


>AF247562-1|AAF70256.1| 2302|Drosophila melanogaster Scribbler long
            isoform protein.
          Length = 2302

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
 Frame = -1

Query: 480  HTGNVLEVLDHMGSRQHMQQEQGECREPLA-----GLEQHQHSMAKQHRMPLLGQQEVPH 316
            H G + +    MGS    QQ+Q + +  +A      ++QH   + +QH+     QQ+  H
Sbjct: 1886 HPGMMHKDEPGMGSAAQQQQQQQQQQMQIAQQQQQAIQQHHQHLQQQHQAQ-QQQQQQQH 1944

Query: 315  LLEQQKVQRRVQL*EQQME 259
              +QQ+ Q++ Q  +QQ +
Sbjct: 1945 QQQQQQQQQQQQQQQQQQQ 1963


>AF242194-1|AAF76322.1| 2302|Drosophila melanogaster brakeless-B
            protein.
          Length = 2302

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
 Frame = -1

Query: 480  HTGNVLEVLDHMGSRQHMQQEQGECREPLA-----GLEQHQHSMAKQHRMPLLGQQEVPH 316
            H G + +    MGS    QQ+Q + +  +A      ++QH   + +QH+     QQ+  H
Sbjct: 1886 HPGMMHKDEPGMGSAAQQQQQQQQQQMQIAQQQQQAIQQHHQHLQQQHQAQ-QQQQQQQH 1944

Query: 315  LLEQQKVQRRVQL*EQQME 259
              +QQ+ Q++ Q  +QQ +
Sbjct: 1945 QQQQQQQQQQQQQQQQQQQ 1963


>AF190403-1|AAF05703.1| 1403|Drosophila melanogaster homeodomain
           transcription factorProspero protein.
          Length = 1403

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH07910
           protein.
          Length = 1266

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 66  HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 122

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 123 QQQHFHQ 129


>AF069997-1|AAC62234.1| 1027|Drosophila melanogaster CLOCK protein.
          Length = 1027

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 755 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 814

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 815 QQQQQQQQQQQQQ 827



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 780 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 837

Query: 255 HR 250
            +
Sbjct: 838 QQ 839


>AF067207-1|AAD10630.1| 1023|Drosophila melanogaster CLOCK protein.
          Length = 1023

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 751 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 810

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 811 QQQQQQQQQQQQQ 823



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 776 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 833

Query: 255 HR 250
            +
Sbjct: 834 QQ 835


>AE014298-1363|AAF46518.1|  644|Drosophila melanogaster CG12653-PA
           protein.
          Length = 644

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQ--HQHSMAKQHRMPL----LGQQEVPHLLEQQKVQRRVQ 280
           ++QH  Q+Q   +      +Q  H H    QH + L      QQ + HL +QQ+ Q++ Q
Sbjct: 13  AQQHQAQQQQHAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQ 72

Query: 279 L*EQQME 259
             +QQ +
Sbjct: 73  QQQQQQQ 79



 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQH-QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H   +QH QQ+Q       A    H  H  A+Q  M  L QQ+     +QQ+ Q++ Q  
Sbjct: 23  HAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQQQQQQQQQQQQQQQQQ 82

Query: 273 EQ-QMELH 253
           +Q Q + H
Sbjct: 83  QQPQQQQH 90


>AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD,
           isoform D protein.
          Length = 1254

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 54  HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 110

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 111 QQQHFHQ 117


>AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC,
           isoform C protein.
          Length = 1254

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q E + P    +Q Q  +  QH   L    + PH L+  + Q++    +
Sbjct: 54  HSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQHL---HKHPHQLQLHQQQQQQLHQQ 110

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 111 QQQHFHQ 117


>AE014297-1287|AAN13500.2| 1374|Drosophila melanogaster CG17228-PD,
           isoform D protein.
          Length = 1374

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>AE014297-1286|AAF54628.2| 1403|Drosophila melanogaster CG17228-PC,
           isoform C protein.
          Length = 1403

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>AE014297-1285|AAN13501.2| 1535|Drosophila melanogaster CG17228-PA,
           isoform A protein.
          Length = 1535

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -1

Query: 459 VLDHMGSRQH---MQQE---QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           +L HMG   H   M Q+   + E R      EQ Q    +Q +     QQE     EQ++
Sbjct: 685 LLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQQQQQQQQQQQQQQQEQQRRFEQEQ 744

Query: 297 VQRRVQL*EQQMELHR 250
            +++ +  EQQ ++ R
Sbjct: 745 QEQQRRKEEQQQQIQR 760


>AE014297-594|AAS65102.1|  692|Drosophila melanogaster CG32466-PB,
           isoform B protein.
          Length = 692

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N +EV+     +Q  QQ+Q + ++     + H H    QH +P   QQ VP   +QQ+ Q
Sbjct: 479 NAMEVMHQQQQQQQQQQQQQQQQQQQQQQQAHHHH--PQHGVP--PQQHVPPQQQQQQQQ 534

Query: 291 RR 286
           ++
Sbjct: 535 QQ 536


>AE014297-593|AAF54032.3|  946|Drosophila melanogaster CG32466-PA,
           isoform A protein.
          Length = 946

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N +EV+     +Q  QQ+Q + ++     + H H    QH +P   QQ VP   +QQ+ Q
Sbjct: 733 NAMEVMHQQQQQQQQQQQQQQQQQQQQQQQAHHHH--PQHGVP--PQQHVPPQQQQQQQQ 788

Query: 291 RR 286
           ++
Sbjct: 789 QQ 790


>AE014296-1322|AAX52754.1|  961|Drosophila melanogaster CG7391-PF,
           isoform F protein.
          Length = 961

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 689 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 748

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 749 QQQQQQQQQQQQQ 761



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 714 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 771

Query: 255 HR 250
            +
Sbjct: 772 QQ 773


>AE014296-1321|AAX52753.1| 1027|Drosophila melanogaster CG7391-PD,
           isoform D protein.
          Length = 1027

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 755 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 814

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 815 QQQQQQQQQQQQQ 827



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 780 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 837

Query: 255 HR 250
            +
Sbjct: 838 QQ 839


>AE014296-1320|AAS65057.1| 1027|Drosophila melanogaster CG7391-PC,
           isoform C protein.
          Length = 1027

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 755 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 814

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 815 QQQQQQQQQQQQQ 827



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 780 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 837

Query: 255 HR 250
            +
Sbjct: 838 QQ 839


>AE014296-1319|AAN12019.1| 1023|Drosophila melanogaster CG7391-PB,
           isoform B protein.
          Length = 1023

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 751 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 810

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 811 QQQQQQQQQQQQQ 823



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 776 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 833

Query: 255 HR 250
            +
Sbjct: 834 QQ 835


>AE014296-1318|AAF50516.1| 1023|Drosophila melanogaster CG7391-PA,
           isoform A protein.
          Length = 1023

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGL-EQHQ-HSMAKQHRMPLLGQQEVPHLLEQQK 298
           N  ++L+    +  MQQ+Q    +    L +QHQ HS  +QH      QQ+     +QQ+
Sbjct: 751 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 810

Query: 297 VQRRVQL*EQQME 259
            Q++ Q  +QQ +
Sbjct: 811 QQQQQQQQQQQQQ 823



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q++ Q  +QQ++L
Sbjct: 776 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQLQL 833

Query: 255 HR 250
            +
Sbjct: 834 QQ 835


>AE013599-2653|AAF57721.1| 2280|Drosophila melanogaster CG5580-PA,
            isoform A protein.
          Length = 2280

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
 Frame = -1

Query: 480  HTGNVLEVLDHMGSRQHMQQEQGECREPLA-----GLEQHQHSMAKQHRMPLLGQQEVPH 316
            H G + +    MGS    QQ+Q + +  +A      ++QH   + +QH+     QQ+  H
Sbjct: 1864 HPGMMHKDEPGMGSAAQQQQQQQQQQMQIAQQQQQAIQQHHQHLQQQHQAQ-QQQQQQQH 1922

Query: 315  LLEQQKVQRRVQL*EQQME 259
              +QQ+ Q++ Q  +QQ +
Sbjct: 1923 QQQQQQQQQQQQQQQQQQQ 1941


>AB044403-1|BAB20792.1| 2310|Drosophila melanogaster master of thick
            veins protein.
          Length = 2310

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
 Frame = -1

Query: 480  HTGNVLEVLDHMGSRQHMQQEQGECREPLA-----GLEQHQHSMAKQHRMPLLGQQEVPH 316
            H G + +    MGS    QQ+Q + +  +A      ++QH   + +QH+     QQ+  H
Sbjct: 1894 HPGMMHKDEPGMGSAAQQQQQQQQQQMQIAQQQQQAIQQHHQHLQQQHQAQ-QQQQQQQH 1952

Query: 315  LLEQQKVQRRVQL*EQQME 259
              +QQ+ Q++ Q  +QQ +
Sbjct: 1953 QQQQQQQQQQQQQQQQQQQ 1971


>BT029401-1|ABK57058.1|   96|Drosophila melanogaster IP02163p
           protein.
          Length = 96

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICC 436
           C   C  CC   CG  C P  G  CC    C  C  P  G    PC  C  CC
Sbjct: 33  CCGPCGPCCGPCCGPCCGPCCG-PCCGP--CGPCCGPC-GPRCGPCGPCGPCC 81


>BT023344-1|AAY55760.1|   72|Drosophila melanogaster IP02161p
           protein.
          Length = 72

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICC 436
           C   C  CC   CG  C P  G  CC    C  C  P  G    PC  C  CC
Sbjct: 9   CCGPCGPCCGPCCGPCCGPCCG-PCCGP--CGPCCGPC-GPRCGPCGPCGPCC 57


>AF175223-1|AAD52614.1| 3469|Drosophila melanogaster SANT domain
           protein SMRTER protein.
          Length = 3469

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 23/86 (26%), Positives = 40/86 (46%)
 Frame = -1

Query: 516 SFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL 337
           S+ ++EQ          L+   H  S Q  QQ+Q + R  L  L+ H H   +Q +    
Sbjct: 44  SYRALEQQQQYAKQAAHLQQQQHQ-SHQQQQQQQQDQRTNL-HLQIHHHHQQQQQQQQQQ 101

Query: 336 GQQEVPHLLEQQKVQRRVQL*EQQME 259
            QQ+     +QQ+ Q++  + +QQ +
Sbjct: 102 QQQQQQQQQQQQQKQQQHHMQQQQQQ 127


>AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC,
           isoform C protein.
          Length = 3604

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + R  L  L+ H H   +Q +     QQ+     +QQ+ Q++  + +
Sbjct: 193 HQSHQQQQQQQQQDQRTNL-HLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251

Query: 270 QQME 259
           QQ +
Sbjct: 252 QQQQ 255


>AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB,
           isoform B protein.
          Length = 3604

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + R  L  L+ H H   +Q +     QQ+     +QQ+ Q++  + +
Sbjct: 193 HQSHQQQQQQQQQDQRTNL-HLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251

Query: 270 QQME 259
           QQ +
Sbjct: 252 QQQQ 255


>AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA,
           isoform A protein.
          Length = 3604

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + R  L  L+ H H   +Q +     QQ+     +QQ+ Q++  + +
Sbjct: 193 HQSHQQQQQQQQQDQRTNL-HLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251

Query: 270 QQME 259
           QQ +
Sbjct: 252 QQQQ 255


>AE014297-604|AAF54026.1|   72|Drosophila melanogaster CG17935-PA
           protein.
          Length = 72

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICC 436
           C   C  CC   CG  C P  G  CC    C  C  P  G    PC  C  CC
Sbjct: 9   CCGPCGPCCGPCCGPCCGPCCG-PCCGP--CGPCCGPC-GPRCGPCGPCGPCC 57


>AE013599-3283|AAM71018.2| 2968|Drosophila melanogaster CG13492-PB,
            isoform B protein.
          Length = 2968

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +2

Query: 269  CSYSCTLRCTFCCSNRCGTSCCPSSGILC--C-FAILCWCCSNPASGS 403
            CS   +  CT C +N C     PS+ + C  C  A    C  NPAS S
Sbjct: 1165 CSSDGSTNCTICSTNNCNNDVYPSNWLTCLRCDSASDADCALNPASYS 1212


>AE013599-3282|AAF46766.2| 2931|Drosophila melanogaster CG13492-PA,
            isoform A protein.
          Length = 2931

 Score = 31.9 bits (69), Expect = 0.74
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +2

Query: 269  CSYSCTLRCTFCCSNRCGTSCCPSSGILC--C-FAILCWCCSNPASGS 403
            CS   +  CT C +N C     PS+ + C  C  A    C  NPAS S
Sbjct: 1128 CSSDGSTNCTICSTNNCNNDVYPSNWLTCLRCDSASDADCALNPASYS 1175


>BT022160-1|AAY51554.1|  520|Drosophila melanogaster IP01388p
           protein.
          Length = 520

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           I ++L   H  NV  +       QHMQQ+  + +      +Q Q   A+Q +     QQ+
Sbjct: 444 INESLHSQHISNVSGLSIQQQINQHMQQQAAQQQAQQQAAQQQQQQAAQQQQQ-AAQQQQ 502

Query: 324 VPHLLEQQKVQRR 286
           + HL   Q V+ R
Sbjct: 503 LLHLPMGQAVKAR 515


>BT003186-1|AAO24941.1|  756|Drosophila melanogaster RE65015p
           protein.
          Length = 756

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 341 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 398



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 360 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 418


>AY128472-1|AAM75065.1|  836|Drosophila melanogaster RE28238p
           protein.
          Length = 836

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 418 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 475



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 437 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 495


>AY118393-1|AAM48422.1|  535|Drosophila melanogaster RE47124p
           protein.
          Length = 535

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -1

Query: 438 RQHMQQEQGECR-EPLAGLEQHQHSMAKQHR-MPLLGQQEVP--HLLEQQKVQRRVQL*E 271
           +QH QQ+Q     + LA    H HS  ++     L+ +Q  P  HL +QQ+ Q++ Q  +
Sbjct: 377 QQHQQQQQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQSTPKHHLQQQQQQQQQQQAQQ 436

Query: 270 QQMELHR 250
           QQ   HR
Sbjct: 437 QQQAQHR 443


>AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p
           protein.
          Length = 270

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 17/70 (24%), Positives = 32/70 (45%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           EQT   +++G  + + D +  +   QQ+QG     +   +Q+Q   A  +R P     + 
Sbjct: 58  EQTQQYVNSGQQIRIKDTVAEQIRAQQQQGYVAPSVRDYQQYQPQQA-AYRPPAQAAPQP 116

Query: 321 PHLLEQQKVQ 292
           P  ++Q   Q
Sbjct: 117 PRRIQQSSYQ 126


>AY069721-1|AAL39866.1|  285|Drosophila melanogaster LP02658p
           protein.
          Length = 285

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           I ++L   H  NV  +       QHMQQ+  + +      +Q Q   A+Q +     QQ+
Sbjct: 209 INESLHSQHISNVSGLSIQQQINQHMQQQAAQQQAQQQAAQQQQQQAAQQQQQ-AAQQQQ 267

Query: 324 VPHLLEQQKVQRR 286
           + HL   Q V+ R
Sbjct: 268 LLHLPMGQAVKAR 280


>AF065133-1|AAC39101.1| 1015|Drosophila melanogaster CLOCK protein.
          Length = 1015

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQ-HQ-HSMAKQH-RMPLLGQQEVPHLLEQQ 301
           N  ++L+    +  MQQ+Q    +    L+Q HQ HS  +QH +     QQ+     +QQ
Sbjct: 751 NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 810

Query: 300 KVQRRVQL*EQQMELHR 250
           + Q++ Q  +QQ++L +
Sbjct: 811 QQQQQQQQQQQQLQLQQ 827



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           QH  Q+Q +    L    Q QH   +Q +     QQ+     +QQ+ Q+++QL +Q
Sbjct: 776 QHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQ---QQQQQQQQQQQQQQQQLQLQQQ 828


>AE014298-690|AAF45994.2|  543|Drosophila melanogaster CG32772-PA
           protein.
          Length = 543

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           I ++L   H  NV  +       QHMQQ+  + +      +Q Q   A+Q +     QQ+
Sbjct: 467 INESLHSQHISNVSGLSIQQQINQHMQQQAAQQQAQQQAAQQQQQQAAQQQQQ-AAQQQQ 525

Query: 324 VPHLLEQQKVQRR 286
           + HL   Q V+ R
Sbjct: 526 LLHLPMGQAVKAR 538


>AE014297-4674|AAO41616.1|  578|Drosophila melanogaster CG12071-PB,
           isoform B protein.
          Length = 578

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 8/116 (6%)
 Frame = -1

Query: 564 STNKSFVLSLCRKALCSFSSIEQTLVQIHTGN---VLEVLDHMGSRQ-----HMQQEQGE 409
           STNK+F  ++C K L     +    ++IHTG    + EV +   +R+     HM + +  
Sbjct: 180 STNKAFECTVCGKGLARKDKL-TIHMRIHTGEKPYICEVCNKAFARRDKLVIHMNKFKHV 238

Query: 408 CREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYG 241
               +A L +  ++M K+   P    ++    LE Q  Q+ VQ+  Q + +    G
Sbjct: 239 TPTNIAPLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQSAQG 294


>AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-PA
           protein.
          Length = 270

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 17/70 (24%), Positives = 32/70 (45%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           EQT   +++G  + + D +  +   QQ+QG     +   +Q+Q   A  +R P     + 
Sbjct: 58  EQTQQYVNSGQQIRIKDTVAEQIRAQQQQGYVAPSVRDYQQYQPQQA-AYRPPAQAAPQP 116

Query: 321 PHLLEQQKVQ 292
           P  ++Q   Q
Sbjct: 117 PRRIQQSSYQ 126


>AE014296-1152|AAS65070.1| 1833|Drosophila melanogaster CG10107-PC,
           isoform C protein.
          Length = 1833

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + ++P    +Q Q  +   H+   + Q +  H  +QQ+  +     +
Sbjct: 81  HQQQQQQQQQQQQQQQQPQQQHQQQQQQVVMHHQQHQVQQVQQVHYQQQQQEPQ-----Q 135

Query: 270 QQMELH 253
           QQ +LH
Sbjct: 136 QQQQLH 141



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 23/90 (25%), Positives = 38/90 (42%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           HM  +Q  QQ+Q    +P     QH   +       L     V H+ +Q+K Q+ +Q  +
Sbjct: 141 HM-EQQQQQQQQYVQHQPQQPAIQHTQQIYYTSEQVLQPNAIVQHMQQQKKQQQVLQQQQ 199

Query: 270 QQMELHRGYGRSEGRCCYQRTQCPAGDINL 181
           QQ + ++ +  +     YQ    P G   L
Sbjct: 200 QQQQQYQQHAPA-----YQVQSSPQGQAQL 224


>AE014296-1151|AAF50646.3| 1833|Drosophila melanogaster CG10107-PA,
           isoform A protein.
          Length = 1833

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + ++P    +Q Q  +   H+   + Q +  H  +QQ+  +     +
Sbjct: 81  HQQQQQQQQQQQQQQQQPQQQHQQQQQQVVMHHQQHQVQQVQQVHYQQQQQEPQ-----Q 135

Query: 270 QQMELH 253
           QQ +LH
Sbjct: 136 QQQQLH 141



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 23/90 (25%), Positives = 38/90 (42%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           HM  +Q  QQ+Q    +P     QH   +       L     V H+ +Q+K Q+ +Q  +
Sbjct: 141 HM-EQQQQQQQQYVQHQPQQPAIQHTQQIYYTSEQVLQPNAIVQHMQQQKKQQQVLQQQQ 199

Query: 270 QQMELHRGYGRSEGRCCYQRTQCPAGDINL 181
           QQ + ++ +  +     YQ    P G   L
Sbjct: 200 QQQQQYQQHAPA-----YQVQSSPQGQAQL 224


>AE014134-2320|AAN10833.1|  836|Drosophila melanogaster CG6043-PC,
           isoform C protein.
          Length = 836

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 418 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 475



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 437 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 495


>AE014134-2318|AAN10831.1|  759|Drosophila melanogaster CG6043-PB,
           isoform B protein.
          Length = 759

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 341 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 398



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 360 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 418


>AE014134-2317|AAF53274.2|  759|Drosophila melanogaster CG6043-PA,
           isoform A protein.
          Length = 759

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 341 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 398



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 360 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 418


>AE014134-2316|AAN10830.1|  918|Drosophila melanogaster CG6043-PD,
           isoform D protein.
          Length = 918

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ       PLA ++Q Q    +Q +   L QQ+   L +QQ  Q+  QL +QQ +
Sbjct: 341 QQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQ--QQLQQLQQQQFQ 398



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++ L   +Q Q    +Q    L  QQ     L+QQ+ Q++ QL +QQ +
Sbjct: 360 QQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQQQQFQQQ-QLQQQQQQ 418


>BT024280-1|ABC86342.1| 1129|Drosophila melanogaster IP14311p
           protein.
          Length = 1129

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +QH QQ Q +  +     +QHQ+    QH+     QQ      +QQ+ Q+
Sbjct: 416 QQHQQQHQQQQHQQQQHQQQHQYQQQHQHQHHQAPQQHQQQAPQQQQYQK 465


>AY119105-1|AAM50965.1|  259|Drosophila melanogaster RE07996p
           protein.
          Length = 259

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 7/73 (9%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQ---HQHSMAKQH--RMPLLGQQEVPHL--LEQQKVQ 292
           H   +QH QQ+    +     L+Q   H H ++  H    P   QQ+  H    +QQ+ Q
Sbjct: 61  HQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQQQQQ 120

Query: 291 RRVQL*EQQMELH 253
           + + L  QQ + H
Sbjct: 121 QALHLQHQQQQQH 133


>AE014298-938|AAF46192.1| 1125|Drosophila melanogaster CG14441-PA
            protein.
          Length = 1125

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 20/73 (27%), Positives = 34/73 (46%)
 Frame = -1

Query: 471  NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
            +V E       +Q  QQ+Q + +       Q Q  M +  R+    QQ+   L +QQ+ Q
Sbjct: 895  SVKEQQQQQQQQQQHQQQQEQQQRQQEMQRQQQQQMEQMERLKQQRQQQELLLQQQQQQQ 954

Query: 291  RRVQL*EQQMELH 253
            ++ Q  +QQ+  H
Sbjct: 955  QQQQQQQQQLRHH 967


>AE014296-1939|AAF50073.2|  558|Drosophila melanogaster CG6175-PB
           protein.
          Length = 558

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 7/73 (9%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQ---HQHSMAKQH--RMPLLGQQEVPHL--LEQQKVQ 292
           H   +QH QQ+    +     L+Q   H H ++  H    P   QQ+  H    +QQ+ Q
Sbjct: 360 HQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQQQQQ 419

Query: 291 RRVQL*EQQMELH 253
           + + L  QQ + H
Sbjct: 420 QALHLQHQQQQQH 432


>AE013599-2063|AAF58133.2| 1135|Drosophila melanogaster CG12964-PA
           protein.
          Length = 1135

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +QH QQ Q +  +     +QHQ+    QH+     QQ      +QQ+ Q+
Sbjct: 422 QQHQQQHQQQQHQQQQHQQQHQYQQQHQHQHHQAPQQHQQQAPQQQQYQK 471


>X51549-1|CAA35924.1| 1394|Drosophila melanogaster protein (
           Drosophila mRNA forecdysone-inducible gene E75B. ).
          Length = 1394

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 11/113 (9%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHM--QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           +QT  Q H   ++ +  + G   H+    +Q +    L    QHQH   +Q +   L QQ
Sbjct: 30  QQTTQQQHATTIVLLTGNGGGNLHIVATPQQHQPMHQLHHQHQHQHQHQQQAKSQQLKQQ 89

Query: 327 E---------VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
                      P   +QQ  ++ V L +QQ +  R   ++E     Q+ Q PA
Sbjct: 90  HSALVKLLESAPIKQQQQTPKQIVYLQQQQQQPQRKRLKNEAAIVQQQQQTPA 142


>M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein.
          Length = 2038

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH QQ+Q +  +     +Q  H   +Q     L QQ++    +QQ+ Q+ +Q  + Q +
Sbjct: 1510 QQHHQQQQQQTHQQQQQHQQQHHQQQQQQ----LTQQQLQQQQQQQQQQQHLQQQQHQQQ 1565

Query: 258  LHR 250
             H+
Sbjct: 1566 HHQ 1568


>BT029664-1|ABL75722.1|  294|Drosophila melanogaster IP17310p
           protein.
          Length = 294

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 4/65 (6%)
 Frame = -1

Query: 447 MGSRQHMQQ--EQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK--VQRRVQ 280
           M   Q +QQ       ++  A  +Q Q SM +Q + PL+ QQ++P L++QQ   VQ++  
Sbjct: 4   MPLEQQLQQLLHSQPAQQQQAMSQQQQQSMVQQQQQPLVQQQQLP-LVQQQPPLVQQQQP 62

Query: 279 L*EQQ 265
           L + Q
Sbjct: 63  LVQHQ 67


>BT028816-1|ABI34197.1|  482|Drosophila melanogaster RT01022p
           protein.
          Length = 482

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>BT021311-1|AAX33459.1|  523|Drosophila melanogaster RE14763p
           protein.
          Length = 523

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 11/113 (9%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHM--QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           +QT  Q H   ++ +  + G   H+    +Q +    L    QHQH   +Q +   L QQ
Sbjct: 30  QQTTQQQHATTIVLLTGNGGGNLHIVATPQQHQPMHQLHHQHQHQHQHQQQAKSQQLKQQ 89

Query: 327 E---------VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
                      P   +QQ  ++ V L +QQ +  R   ++E     Q+ Q PA
Sbjct: 90  HSALVKLLESAPIKQQQQTPKQIVYLQQQQQQPQRKRLKNEAAIVQQQQQTPA 142


>BT016125-1|AAV37010.1|  500|Drosophila melanogaster GM16860p
           protein.
          Length = 500

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>AY113276-1|AAM29281.1|  120|Drosophila melanogaster AT17606p
           protein.
          Length = 120

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCT--LRCTF-CCSNRCGTSCCPSSGILCC 358
           LC   CC  +C+  L C   CC    G  CC   G  CC
Sbjct: 61  LCLCGCCGLACSACLACDEGCCGEGGGGGCCGDDGGGCC 99


>AE014296-2991|AAN11688.1| 1355|Drosophila melanogaster CG8127-PA,
           isoform A protein.
          Length = 1355

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 11/113 (9%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHM--QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           +QT  Q H   ++ +  + G   H+    +Q +    L    QHQH   +Q +   L QQ
Sbjct: 30  QQTTQQQHATTIVLLTGNGGGNLHIVATPQQHQPMHQLHHQHQHQHQHQQQAKSQQLKQQ 89

Query: 327 E---------VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
                      P   +QQ  ++ V L +QQ +  R   ++E     Q+ Q PA
Sbjct: 90  HSALVKLLESAPIKQQQQTPKQIVYLQQQQQQPQRKRLKNEAAIVQQQQQTPA 142


>AE014134-793|AAF50966.2|  510|Drosophila melanogaster CG11924-PA,
           isoform A protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>AE014134-792|AAO41153.1|  482|Drosophila melanogaster CG11924-PC,
           isoform C protein.
          Length = 482

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>AE014134-791|AAO41152.1|  482|Drosophila melanogaster CG11924-PB,
           isoform B protein.
          Length = 482

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>AE014134-790|AAO41151.1|  514|Drosophila melanogaster CG11924-PD,
           isoform D protein.
          Length = 514

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+   LLEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQ 275


>AE013599-3295|AAF46776.2|  120|Drosophila melanogaster CG13494-PA
           protein.
          Length = 120

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCT--LRCTF-CCSNRCGTSCCPSSGILCC 358
           LC   CC  +C+  L C   CC    G  CC   G  CC
Sbjct: 61  LCLCGCCGLACSACLACDEGCCGEGGGGGCCGDDGGGCC 99


>D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked
           protein protein.
          Length = 1408

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 375 QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
           QH   +QH+  L  QQ++ H   QQ+ Q++ Q  +QQ++     GRS  R
Sbjct: 500 QHQQQQQHQ--LQQQQQLQHQATQQQQQQQQQ--QQQLQHKYNVGRSRSR 545


>BT030438-1|ABO52858.1|  520|Drosophila melanogaster IP18557p
           protein.
          Length = 520

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQ---HSMAKQHRMPLLGQQEVPH 316
           +QH QQ+Q + ++     +Q Q   H   +QH     GQQ+ PH
Sbjct: 442 QQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHPH 485



 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q + ++     +QHQ    +QH+      Q+      QQ+ Q   Q   QQ   
Sbjct: 425 QQQQQQQHQQQQQQQQQQQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHP 484

Query: 255 H 253
           H
Sbjct: 485 H 485


>BT029042-1|ABJ16975.1|  128|Drosophila melanogaster IP04527p
           protein.
          Length = 128

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 3/73 (4%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSN-PASG 400
           PSL     C ++CCS         CC +    + C SS   +   FA   WC ++  A G
Sbjct: 53  PSLAHWFSCRTLCCSSVSPRPFVSCCGSMATPTACASSQSCVWAPFAKWFWCAASWAACG 112

Query: 401 SLHSPCSCCICCR 439
            L    S   C R
Sbjct: 113 RLPLAQSVDSCLR 125


>AY060380-1|AAL25419.1| 1202|Drosophila melanogaster LD27118p
           protein.
          Length = 1202

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL 340
           H  S    QQ+Q +   PL    QHQHS    H  P+
Sbjct: 48  HFNSNHFYQQQQPQQLAPLNASHQHQHSHPHPHPHPV 84


>AJ131022-1|CAB55429.1|  523|Drosophila melanogaster C2H2 zinc
           finger transcriptionfactor protein.
          Length = 523

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQ---HSMAKQHRMPLLGQQEVPH 316
           +QH QQ+Q + ++     +Q Q   H   +QH     GQQ+ PH
Sbjct: 445 QQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHPH 488



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH QQ+Q + ++     +QHQ    +QH+      Q+      QQ+ Q   Q   QQ  
Sbjct: 430 QQHQQQQQQQQQQQQ---QQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQH 486

Query: 258 LH 253
            H
Sbjct: 487 PH 488



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = -1

Query: 432 HMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           H QQ+Q + ++     +Q Q    +QH+     QQ+  H  +QQ+ Q++ Q   QQ + H
Sbjct: 424 HQQQQQQQHQQQ---QQQQQQQQQQQHQQ----QQQQQHQQQQQQHQQQQQQHHQQQQQH 476


>AF018078-1|AAB70303.1|  654|Drosophila melanogaster unknown
           protein.
          Length = 654

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = -1

Query: 399 PLAGLE-QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E-QQMEL 256
           P AGL  Q+    A Q +  L  QQE    L+QQ++Q++VQ+   QQ++L
Sbjct: 228 PPAGLPPQYTPPCAPQQQQVLQQQQEQQRFLQQQQLQQQVQVQHPQQLQL 277


>AE014298-2553|AAO41690.1| 1509|Drosophila melanogaster CG5424-PC,
           isoform C protein.
          Length = 1509

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 375 QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
           QH   +QH+  L  QQ++ H   QQ+ Q++ Q  +QQ++     GRS  R
Sbjct: 600 QHQQQQQHQ--LQQQQQLQHQATQQQQQQQQQ--QQQLQHKYNVGRSRSR 645


>AE014298-2552|AAO41689.1| 1436|Drosophila melanogaster CG5424-PD,
           isoform D protein.
          Length = 1436

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 375 QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
           QH   +QH+  L  QQ++ H   QQ+ Q++ Q  +QQ++     GRS  R
Sbjct: 527 QHQQQQQHQ--LQQQQQLQHQATQQQQQQQQQ--QQQLQHKYNVGRSRSR 572


>AE014298-2551|AAF48718.2| 1436|Drosophila melanogaster CG5424-PB,
           isoform B protein.
          Length = 1436

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 375 QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
           QH   +QH+  L  QQ++ H   QQ+ Q++ Q  +QQ++     GRS  R
Sbjct: 527 QHQQQQQHQ--LQQQQQLQHQATQQQQQQQQQ--QQQLQHKYNVGRSRSR 572


>AE014298-2550|ABI30989.1| 1918|Drosophila melanogaster CG5424-PF,
            isoform F protein.
          Length = 1918

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 375  QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
            QH   +QH+  L  QQ++ H   QQ+ Q++ Q  +QQ++     GRS  R
Sbjct: 1013 QHQQQQQHQ--LQQQQQLQHQATQQQQQQQQQ--QQQLQHKYNVGRSRSR 1058


>AE014298-1365|AAN09612.1|  520|Drosophila melanogaster CG1343-PB,
           isoform B protein.
          Length = 520

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQ---HSMAKQHRMPLLGQQEVPH 316
           +QH QQ+Q + ++     +Q Q   H   +QH     GQQ+ PH
Sbjct: 442 QQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHPH 485



 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q + ++     +QHQ    +QH+      Q+      QQ+ Q   Q   QQ   
Sbjct: 425 QQQQQQQHQQQQQQQQQQQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHP 484

Query: 255 H 253
           H
Sbjct: 485 H 485


>AE014298-1364|AAF46519.2|  691|Drosophila melanogaster CG1343-PA,
           isoform A protein.
          Length = 691

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQ---HSMAKQHRMPLLGQQEVPH 316
           +QH QQ+Q + ++     +Q Q   H   +QH     GQQ+ PH
Sbjct: 613 QQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHPH 656



 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q + ++     +QHQ    +QH+      Q+      QQ+ Q   Q   QQ   
Sbjct: 596 QQQQQQQHQQQQQQQQQQQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQHHHQQFGQQQHP 655

Query: 255 H 253
           H
Sbjct: 656 H 656


>AE014296-2342|AAF49773.3| 3146|Drosophila melanogaster CG9007-PA
            protein.
          Length = 3146

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 18/54 (33%), Positives = 30/54 (55%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            RQ  QQ+Q +  +P A + Q QH         ++G Q+  H L+QQ+ Q++ Q+
Sbjct: 1566 RQPQQQQQQQSPKPQALVAQQQH---------VVGAQQQQHFLQQQQKQQQQQM 1610


>AE013599-3137|AAF46678.2| 1202|Drosophila melanogaster CG30388-PA
           protein.
          Length = 1202

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL 340
           H  S    QQ+Q +   PL    QHQHS    H  P+
Sbjct: 48  HFNSNHFYQQQQPQQLAPLNASHQHQHSHPHPHPHPV 84


>AE013599-869|AAF58935.1|  254|Drosophila melanogaster CG13953-PA
           protein.
          Length = 254

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 20/81 (24%), Positives = 33/81 (40%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLE 307
           Q H  +  +   H+G     Q  Q   ++    +   QHS+A+Q    L  QQ +    +
Sbjct: 130 QQHLQSQHQQQQHLGQHHTQQHSQQHAQQQQQLMTHQQHSVAQQQHHHLQQQQHLQQ-QQ 188

Query: 306 QQKVQRRVQL*EQQMELHRGY 244
           QQ          QQ+ LH+ +
Sbjct: 189 QQHHHHHHHHHHQQLSLHQNH 209


>BT030423-1|ABO52843.1|  506|Drosophila melanogaster IP17710p
           protein.
          Length = 506

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQ--GECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           ++TL +  +  +     H   + H+      G    P    EQ  H    QH   L  QQ
Sbjct: 211 DRTLSEAGSSPIPNTNMHEAHKNHLLNSPAGGRSVTPRQAHEQLHHHPHTQHH--LQQQQ 268

Query: 327 EVPHLLEQQKVQRRVQL*EQQMELHRGY 244
           +      QQ  Q+++Q  +QQ +LH G+
Sbjct: 269 QQLQQQHQQLQQQQLQQHQQQQQLHHGH 296


>BT030127-1|ABN49266.1|  233|Drosophila melanogaster IP14886p
           protein.
          Length = 233

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 140 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 196

Query: 294 QRR 286
           Q+R
Sbjct: 197 QQR 199


>BT023765-1|AAZ41773.1|  701|Drosophila melanogaster RE18252p
           protein.
          Length = 701

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQ--GECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           ++TL +  +  +     H   + H+      G    P    EQ  H    QH   L  QQ
Sbjct: 406 DRTLSEAGSSPIPNTNMHEAHKNHLLNSPAGGRSVTPRQAHEQLHHHPHTQHH--LQQQQ 463

Query: 327 EVPHLLEQQKVQRRVQL*EQQMELHRGY 244
           +      QQ  Q+++Q  +QQ +LH G+
Sbjct: 464 QQLQQQHQQLQQQQLQQHQQQQQLHHGH 491


>BT015224-1|AAT94453.1|  697|Drosophila melanogaster RE33368p
           protein.
          Length = 697

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 435 QHMQQEQGECREPLA-GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q+ QQ+Q +  E  A   EQH     +QH++ LL  Q+    L+Q       Q  +QQ +
Sbjct: 544 QYQQQQQQQFEELQAQAQEQHLQQQHQQHQLQLLQLQQQQQQLQQPVQHHPPQQLQQQQQ 603


>BT001611-1|AAN71366.1|  697|Drosophila melanogaster RE32656p
           protein.
          Length = 697

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 435 QHMQQEQGECREPLA-GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q+ QQ+Q +  E  A   EQH     +QH++ LL  Q+    L+Q       Q  +QQ +
Sbjct: 544 QYQQQQQQQFEELQAQAQEQHLQQQHQQHQLQLLQLQQQQQQLQQPVQHHPPQQLQQQQQ 603


>BT001532-1|AAN71287.1|  411|Drosophila melanogaster RE06837p
           protein.
          Length = 411

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 139 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 195

Query: 294 QRR 286
           Q+R
Sbjct: 196 QQR 198


>AY070526-1|AAL47997.1|  647|Drosophila melanogaster GH27708p
           protein.
          Length = 647

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEV--PHLLEQQKVQRRVQL*EQQMELHRGY 244
           +Q QH   +QH+  L    +    H+L+QQ+ Q++     Q  + H G+
Sbjct: 126 QQQQHQQQQQHQQHLQQHHQAHHQHVLQQQQQQQQQHSQHQHQQQHHGH 174


>AY058369-1|AAL13598.1|  389|Drosophila melanogaster GH13848p
           protein.
          Length = 389

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 174 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 230

Query: 294 QRR 286
           Q+R
Sbjct: 231 QQR 233


>AY051994-1|AAK93418.1|  736|Drosophila melanogaster LD46233p
           protein.
          Length = 736

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = -1

Query: 468 VLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           VL+ ++H    Q  QQ+  + ++     +Q QH   + H+M L  Q ++P
Sbjct: 588 VLQQMNHQQQHQQHQQQPPQQQQQHPQQQQQQHLQQQPHQMQLPQQPKLP 637


>AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L long
           isoform protein.
          Length = 5322

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/71 (29%), Positives = 33/71 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q       + LA L+Q Q   A+Q +  +  QQ+ P   +QQ    + Q    Q +
Sbjct: 538 QQHQQWGAAHGAQHLAALQQQQ---AQQQQQQVQQQQQAPPQQQQQAAMLQAQQQHHQQQ 594

Query: 258 LHRGYGRSEGR 226
           L   YG+  G+
Sbjct: 595 LSM-YGQPMGQ 604



 Score = 29.9 bits (64), Expect = 3.0
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           +E       +Q   Q+Q + ++P A L    H    QH+ P+  QQ+ PH
Sbjct: 697 METTQPTQQQQQTSQQQQQPQQPQATLTSPHHQQM-QHQSPIHQQQQSPH 745


>AF173847-1|AAD48878.1|  535|Drosophila melanogaster Zn finger
           transcription factor protein.
          Length = 535

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -1

Query: 438 RQHMQQEQGECR-EPLAGLEQHQHSMAKQHR-MPLLGQQEVP--HLLEQQKVQRRVQL*E 271
           +QH QQ+Q     + LA    H HS  ++     L+ +Q  P  HL +QQ+ Q++ Q  +
Sbjct: 377 QQHQQQQQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQSTPQHHLQQQQQQQQQQQAQQ 436

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 437 QQQAQHQ 443


>AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA,
            isoform A protein.
          Length = 2602

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 22/77 (28%), Positives = 36/77 (46%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            L H   +Q  QQ+Q +  +     +Q + +M +QH      QQ+   L +QQ  Q+R   
Sbjct: 1950 LHHHLQQQQQQQQQQQHHQQQQQQQQLEDAMEEQHMATDHQQQQQQQLGQQQGQQQRFL- 2008

Query: 276  *EQQMELHRGYGRSEGR 226
             +QQ  LH     + G+
Sbjct: 2009 -KQQSYLHSARKSNAGQ 2024


>AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB,
            isoform B protein.
          Length = 2693

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 22/77 (28%), Positives = 36/77 (46%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            L H   +Q  QQ+Q +  +     +Q + +M +QH      QQ+   L +QQ  Q+R   
Sbjct: 2041 LHHHLQQQQQQQQQQQHHQQQQQQQQLEDAMEEQHMATDHQQQQQQQLGQQQGQQQRFL- 2099

Query: 276  *EQQMELHRGYGRSEGR 226
             +QQ  LH     + G+
Sbjct: 2100 -KQQSYLHSARKSNAGQ 2115


>AE014298-1322|AAF46483.1|  663|Drosophila melanogaster CG17446-PA
           protein.
          Length = 663

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = -1

Query: 426 QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QQ+Q + ++ L   +Q Q    +Q +     QQ++    +QQ+ Q++ Q  +QQ++L
Sbjct: 572 QQKQYQEKQKLMLQQQQQQQQQQQQQQQQQQQQQLQQPQQQQQQQQQQQQEQQQLQL 628


>AE014297-3614|AAN14015.2|  697|Drosophila melanogaster CG13627-PB,
           isoform B protein.
          Length = 697

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 435 QHMQQEQGECREPLA-GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q+ QQ+Q +  E  A   EQH     +QH++ LL  Q+    L+Q       Q  +QQ +
Sbjct: 544 QYQQQQQQQFEELQAQAQEQHLQQQHQQHQLQLLQLQQQQQQLQQPVQHHPPQQLQQQQQ 603


>AE014297-3613|AAF56325.1|  697|Drosophila melanogaster CG13627-PA,
           isoform A protein.
          Length = 697

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 435 QHMQQEQGECREPLA-GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q+ QQ+Q +  E  A   EQH     +QH++ LL  Q+    L+Q       Q  +QQ +
Sbjct: 544 QYQQQQQQQFEELQAQAQEQHLQQQHQQHQLQLLQLQQQQQQLQQPVQHHPPQQLQQQQQ 603


>AE014297-2637|AAF55644.2|  535|Drosophila melanogaster CG5557-PA
           protein.
          Length = 535

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -1

Query: 438 RQHMQQEQGECR-EPLAGLEQHQHSMAKQHR-MPLLGQQEVP--HLLEQQKVQRRVQL*E 271
           +QH QQ+Q     + LA    H HS  ++     L+ +Q  P  HL +QQ+ Q++ Q  +
Sbjct: 377 QQHQQQQQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQSTPQHHLQQQQQQQQQQQAQQ 436

Query: 270 QQMELHR 250
           QQ   H+
Sbjct: 437 QQQAQHQ 443


>AE014297-1770|AAF54997.1|  524|Drosophila melanogaster CG9930-PA
           protein.
          Length = 524

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ--QEVPHLLEQQKVQRRVQL*EQQ 265
           +Q MQQ  GE    L+   Q QH + +QH+  L  Q  Q+  H ++QQ+ Q  ++  E++
Sbjct: 451 QQFMQQNAGEAAT-LS--PQQQHQLLQQHQQHLQQQHHQQQQHFIQQQQ-QLYLRERERE 506

Query: 264 MELHRGYGRSEGR 226
            E  R   R + R
Sbjct: 507 REREREREREKSR 519


>AE014296-1332|AAN12025.1|  647|Drosophila melanogaster CG17888-PD,
           isoform D protein.
          Length = 647

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEV--PHLLEQQKVQRRVQL*EQQMELHRGY 244
           +Q QH   +QH+  L    +    H+L+QQ+ Q++     Q  + H G+
Sbjct: 126 QQQQHQQQQQHQQHLQQHHQAHHQHVLQQQQQQQQQHSQHQHQQQHHGH 174


>AE014296-762|AAN11585.1|  389|Drosophila melanogaster CG14995-PB,
           isoform B protein.
          Length = 389

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 174 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 230

Query: 294 QRR 286
           Q+R
Sbjct: 231 QQR 233


>AE014296-761|AAF47837.1|  454|Drosophila melanogaster CG14995-PA,
           isoform A protein.
          Length = 454

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 139 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 195

Query: 294 QRR 286
           Q+R
Sbjct: 196 QQR 198


>AE014296-760|AAN11584.1|  411|Drosophila melanogaster CG14995-PC,
           isoform C protein.
          Length = 411

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 139 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 195

Query: 294 QRR 286
           Q+R
Sbjct: 196 QQR 198


>AE014296-759|AAN11583.1|  354|Drosophila melanogaster CG14995-PD,
           isoform D protein.
          Length = 354

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G V    D +    + QQ+Q     P   L+Q QHS   QH  P   QQ+     +QQ+ 
Sbjct: 139 GGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSY-PQHSPP--PQQQYQQQQQQQQQ 195

Query: 294 QRR 286
           Q+R
Sbjct: 196 QQR 198


>AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA
           protein.
          Length = 2252

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 19/77 (24%), Positives = 36/77 (46%)
 Frame = -1

Query: 495 TLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           TL+   + N      ++  +Q  QQ+Q +  + L   +Q      +Q++ P   QQ+  H
Sbjct: 123 TLLPQQSPNTTSATGNLQQQQQQQQQQYQQHQQLLSQQQLLSQQQQQYQQP---QQQQQH 179

Query: 315 LLEQQKVQRRVQL*EQQ 265
             +QQ+   + Q  +QQ
Sbjct: 180 FQQQQQQHLQQQHAQQQ 196


>AE014134-2732|AAN10947.1|  701|Drosophila melanogaster CG5953-PB,
           isoform B protein.
          Length = 701

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQ--GECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           ++TL +  +  +     H   + H+      G    P    EQ  H    QH   L  QQ
Sbjct: 406 DRTLSEAGSSPIPNTNMHEAHKNHLLNSPAGGRSVTPRQAHEQLHHHPHTQHH--LQQQQ 463

Query: 327 EVPHLLEQQKVQRRVQL*EQQMELHRGY 244
           +      QQ  Q+++Q  +QQ +LH G+
Sbjct: 464 QQLQQQHQQLQQQQLQQHQQQQQLHHGH 491


>AE014134-2731|AAF53541.2|  701|Drosophila melanogaster CG5953-PA,
           isoform A protein.
          Length = 701

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQ--GECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           ++TL +  +  +     H   + H+      G    P    EQ  H    QH   L  QQ
Sbjct: 406 DRTLSEAGSSPIPNTNMHEAHKNHLLNSPAGGRSVTPRQAHEQLHHHPHTQHH--LQQQQ 463

Query: 327 EVPHLLEQQKVQRRVQL*EQQMELHRGY 244
           +      QQ  Q+++Q  +QQ +LH G+
Sbjct: 464 QQLQQQHQQLQQQQLQQHQQQQQLHHGH 491


>AE014134-1945|AAF53004.2|  736|Drosophila melanogaster CG12299-PA
           protein.
          Length = 736

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = -1

Query: 468 VLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           VL+ ++H    Q  QQ+  + ++     +Q QH   + H+M L  Q ++P
Sbjct: 588 VLQQMNHQQQHQQHQQQPPQQQQQHPQQQQQQHLQQQPHQMQLPQQPKLP 637


>AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA,
           isoform A protein.
          Length = 5322

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/71 (29%), Positives = 33/71 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q       + LA L+Q Q   A+Q +  +  QQ+ P   +QQ    + Q    Q +
Sbjct: 538 QQHQQWGAAHGAQHLAALQQQQ---AQQQQQQVQQQQQAPPQQQQQAAMLQAQQQHHQQQ 594

Query: 258 LHRGYGRSEGR 226
           L   YG+  G+
Sbjct: 595 LSM-YGQPMGQ 604



 Score = 29.9 bits (64), Expect = 3.0
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           +E       +Q   Q+Q + ++P A L    H    QH+ P+  QQ+ PH
Sbjct: 697 METTQPTQQQQQTSQQQQQPQQPQATLTSPHHQQM-QHQSPIHQQQQSPH 745


>Y16899-1|CAA76529.1|  712|Drosophila melanogaster
           optomotor-blind-related gene-1 protein.
          Length = 712

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+QG  + P         S    +   LLG Q    L +Q + Q++ Q   QQ  
Sbjct: 458 QQQQQQQQGVLQLPATP----SSSSTSGNSPDLLGYQMEQQLQQQHQQQQQQQHQSQQQH 513

Query: 258 LHRGYGRSEGRCCYQRTQ 205
           LH+ +  ++ +   Q++Q
Sbjct: 514 LHQQHQANQQQSLLQQSQ 531


>X77532-1|CAA54670.1|  450|Drosophila melanogaster serum response
           factor homolog protein.
          Length = 450

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 28/93 (30%), Positives = 41/93 (44%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           +L +MG    MQ+       P A   Q  HS   QH      QQ+     +QQ+ Q++ Q
Sbjct: 45  LLQNMGGVPPMQRPNPAAGAPPAPQCQTLHS--PQHA----SQQQQQQQQQQQQHQQQQQ 98

Query: 279 L*EQQMELHRGYGRSEGRCCYQRTQCPAGDINL 181
             +Q  +  RG  RS G  CY+     +G + L
Sbjct: 99  QQQQHPQQQRGLKRS-GSDCYEDHHRSSGGLTL 130


>BT030119-1|ABN49258.1|  152|Drosophila melanogaster IP12727p
           protein.
          Length = 152

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +2

Query: 329 CCPSSGILC-CFAILCWCCSNPASGSLHSPCSCCICC 436
           CC  + + C C  ++      P +G + +   CC CC
Sbjct: 6   CCCGANVACDCDCVVVVVIITPVAGVVDTAVHCCCCC 42


>BT025148-1|ABE73318.1|  270|Drosophila melanogaster IP04354p
           protein.
          Length = 270

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 11/29 (37%), Positives = 13/29 (44%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGIL 352
           CC Y C   C  CC   C + CC    +L
Sbjct: 10  CCCYCCCCTCCCCC---CCSCCCRCFDVL 35


>BT025086-1|ABE73257.1| 1024|Drosophila melanogaster IP14647p
           protein.
          Length = 1024

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = -1

Query: 396 LAGLEQHQHSMAK--QHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           +AG +QH+ S  +  Q ++  L  Q+  H  +QQ+ Q++ Q  +QQ + H
Sbjct: 80  VAGEDQHRRSSLQGVQEKLTQLQMQQQHHQQQQQQQQQQQQQHQQQQQHH 129


>BT012496-1|AAS93767.1|  421|Drosophila melanogaster HL01444p
           protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -1

Query: 207 QCPAGDINLCSVWRNVLRYSLSVSHVGWSNQRSSGYCWN 91
           Q P+G++ L          S + S  GWS Q  S Y WN
Sbjct: 34  QPPSGNLQLAGNSSESGWRSYNQSSYGWSTQNQSNYAWN 72


>BT010118-1|AAQ22587.1|  961|Drosophila melanogaster AT27581p
           protein.
          Length = 961

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           QHQH +  Q   P   QQ+   +L+QQ+VQ
Sbjct: 750 QHQHHLVVQQTQPQQQQQQQQVVLQQQQVQ 779


>BT003612-1|AAO39615.1|  521|Drosophila melanogaster GH15792p
           protein.
          Length = 521

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 22/84 (26%), Positives = 37/84 (44%)
 Frame = -1

Query: 516 SFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL 337
           S SS    L Q+   NV     H   +Q +QQ+Q   ++     +QH H   +QH +  +
Sbjct: 361 SNSSANNMLQQLSQQNVTVTAHHSQQQQQLQQQQHHQQQ-----QQHSHQQQQQHLLSSV 415

Query: 336 GQQEVPHLLEQQKVQRRVQL*EQQ 265
                 H  +QQ   + ++  +QQ
Sbjct: 416 TITPNFHPAQQQHHHQPMRGHQQQ 439


>BT003320-1|AAO25080.1|  798|Drosophila melanogaster AT11823p
           protein.
          Length = 798

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           S +HMQQ  G  R+  +     +H     HR P   Q   PH
Sbjct: 373 SEEHMQQPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPH 414


>AY095071-1|AAM11399.1|  449|Drosophila melanogaster RE17834p
           protein.
          Length = 449

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 28/93 (30%), Positives = 41/93 (44%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           +L +MG    MQ+       P A   Q  HS   QH      QQ+     +QQ+ Q++ Q
Sbjct: 45  LLQNMGGVPPMQRPNPAAGAPPAPQCQTLHS--PQHA----SQQQQQQQQQQQQHQQQQQ 98

Query: 279 L*EQQMELHRGYGRSEGRCCYQRTQCPAGDINL 181
             +Q  +  RG  RS G  CY+     +G + L
Sbjct: 99  QQQQHPQQQRGLKRS-GSDCYEDHHRSSGGLTL 130


>AY070840-1|AAL48462.1|  790|Drosophila melanogaster GH21062p
           protein.
          Length = 790

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           +L +   +Q  QQ+Q   +E    L+Q Q  H    Q ++P   +Q     L+Q + Q++
Sbjct: 1   MLQYQQPQQQQQQQQLLQQEQQQQLQQQQQQHQHLLQQQLPQQRRQTYKEYLQQHQQQKQ 60

Query: 285 VQL*EQQME 259
            Q  +QQ +
Sbjct: 61  QQQLQQQQQ 69



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 19/62 (30%), Positives = 34/62 (54%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q+ Q +Q + ++ L  L+Q Q    +Q       QQ+  HLL+QQ  Q+R Q  ++ ++ 
Sbjct: 3   QYQQPQQQQQQQQL--LQQEQQQQLQQQ------QQQHQHLLQQQLPQQRRQTYKEYLQQ 54

Query: 255 HR 250
           H+
Sbjct: 55  HQ 56


>AY069327-1|AAL39472.2|  552|Drosophila melanogaster LD04591p
           protein.
          Length = 552

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           S +HMQQ  G  R+  +     +H     HR P   Q   PH
Sbjct: 127 SEEHMQQPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPH 168


>AY060624-1|AAL28172.1|  505|Drosophila melanogaster GH04632p
           protein.
          Length = 505

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = -1

Query: 432 HMQQ-EQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           H QQ +Q + ++PL  L+Q Q    + H+     QQ+   +++Q + Q+++Q  +QQ+
Sbjct: 84  HQQQPQQQQQQQPLTQLQQPQLREREHHQQQ---QQQQQQMMQQPQQQQQMQQPQQQL 138


>AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends long
            isoform protein.
          Length = 5554

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3904 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3958

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3959 HGPQQQQKSPQGVGHLGG 3976


>AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP motif
            protein long isoformprotein.
          Length = 5533

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3910 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3964

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3965 HGPQQQQKSPQGVGHLGG 3982


>AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends
            protein.
          Length = 5476

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3853 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3907

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3908 HGPQQQQKSPQGVGHLGG 3925


>AE014298-1177|AAF46373.1|  699|Drosophila melanogaster CG11202-PA
           protein.
          Length = 699

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+QG  + P         S    +   LLG Q    L +Q + Q++ Q   QQ  
Sbjct: 456 QQQQQQQQGVLQLPATP----SSSSTSGNSPDLLGYQMEQQLQQQHQQQQQQQHQSQQQH 511

Query: 258 LHRGYGRSEGRCCYQRTQ 205
           LH+ +  ++ +   Q++Q
Sbjct: 512 LHQQHQANQQQSLLQQSQ 529


>AE014298-574|ABC67172.1| 1059|Drosophila melanogaster CG32776-PD,
           isoform D protein.
          Length = 1059

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%)
 Frame = -1

Query: 444 GSRQHMQQEQGECR---EPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           G  Q M+Q+Q + +   +P   L+  QH   + H+   L  Q+   L  QQ+ Q++ Q  
Sbjct: 206 GYNQAMEQQQMQQQLHYDPHQELQFEQHQPHQSHQQQQLQHQQQHQLQHQQQHQQQQQYQ 265

Query: 273 EQ--QMELHRGY 244
           +Q  Q + H+ Y
Sbjct: 266 QQQHQQQQHQQY 277


>AE014298-573|AAS72338.2| 1058|Drosophila melanogaster CG32776-PB,
           isoform B protein.
          Length = 1058

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%)
 Frame = -1

Query: 444 GSRQHMQQEQGECR---EPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           G  Q M+Q+Q + +   +P   L+  QH   + H+   L  Q+   L  QQ+ Q++ Q  
Sbjct: 206 GYNQAMEQQQMQQQLHYDPHQELQFEQHQPHQSHQQQQLQHQQQHQLQHQQQHQQQQQYQ 265

Query: 273 EQ--QMELHRGY 244
           +Q  Q + H+ Y
Sbjct: 266 QQQHQQQQHQQY 277


>AE014297-4076|AAF56673.2|  980|Drosophila melanogaster CG6051-PA
           protein.
          Length = 980

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           S +HMQQ  G  R+  +     +H     HR P   Q   PH
Sbjct: 555 SEEHMQQPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQHRQPH 596


>AE014297-1059|AAF54468.3|  521|Drosophila melanogaster CG33975-PA
           protein.
          Length = 521

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 22/84 (26%), Positives = 37/84 (44%)
 Frame = -1

Query: 516 SFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL 337
           S SS    L Q+   NV     H   +Q +QQ+Q   ++     +QH H   +QH +  +
Sbjct: 361 SNSSANNMLQQLSQQNVTVTAHHSQQQQQLQQQQHHQQQ-----QQHSHQQQQQHLLSSV 415

Query: 336 GQQEVPHLLEQQKVQRRVQL*EQQ 265
                 H  +QQ   + ++  +QQ
Sbjct: 416 TITPNFHPAQQQHHHQPMRGHQQQ 439


>AE014296-877|AAF47920.2|  505|Drosophila melanogaster CG32245-PB,
           isoform B protein.
          Length = 505

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = -1

Query: 432 HMQQ-EQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           H QQ +Q + ++PL  L+Q Q    + H+     QQ+   +++Q + Q+++Q  +QQ+
Sbjct: 84  HQQQPQQQQQQQPLTQLQQPQLREREHHQQQ---QQQQQQMMQQPQQQQQMQQPQQQL 138


>AE014296-690|AAF47788.2|  790|Drosophila melanogaster CG32264-PB,
           isoform B protein.
          Length = 790

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           +L +   +Q  QQ+Q   +E    L+Q Q  H    Q ++P   +Q     L+Q + Q++
Sbjct: 1   MLQYQQPQQQQQQQQLLQQEQQQQLQQQQQQHQHLLQQQLPQQRRQTYKEYLQQHQQQKQ 60

Query: 285 VQL*EQQME 259
            Q  +QQ +
Sbjct: 61  QQQLQQQQQ 69



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 19/62 (30%), Positives = 34/62 (54%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q+ Q +Q + ++ L  L+Q Q    +Q       QQ+  HLL+QQ  Q+R Q  ++ ++ 
Sbjct: 3   QYQQPQQQQQQQQL--LQQEQQQQLQQQ------QQQHQHLLQQQLPQQRRQTYKEYLQQ 54

Query: 255 HR 250
           H+
Sbjct: 55  HQ 56


>AE014296-611|AAS64955.1|  958|Drosophila melanogaster CG11505-PC,
           isoform C protein.
          Length = 958

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           QHQH +  Q   P   QQ+   +L+QQ+VQ
Sbjct: 747 QHQHHLVVQQTQPQQQQQQQQVVLQQQQVQ 776


>AE014296-610|AAF47745.1| 1521|Drosophila melanogaster CG11505-PA,
           isoform A protein.
          Length = 1521

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           QHQH +  Q   P   QQ+   +L+QQ+VQ
Sbjct: 747 QHQHHLVVQQTQPQQQQQQQQVVLQQQQVQ 776


>AE014296-609|AAG22237.2| 1531|Drosophila melanogaster CG11505-PB,
           isoform B protein.
          Length = 1531

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           QHQH +  Q   P   QQ+   +L+QQ+VQ
Sbjct: 757 QHQHHLVVQQTQPQQQQQQQQVVLQQQQVQ 786


>AE014134-2438|AAN10861.1|  421|Drosophila melanogaster CG31839-PA
           protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -1

Query: 207 QCPAGDINLCSVWRNVLRYSLSVSHVGWSNQRSSGYCWN 91
           Q P+G++ L          S + S  GWS Q  S Y WN
Sbjct: 34  QPPSGNLQLAGNSSESGWRSYNQSSYGWSTQNQSNYAWN 72


>AE014134-908|AAF52239.3| 2267|Drosophila melanogaster CG14023-PA
            protein.
          Length = 2267

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = -1

Query: 504  IEQTLVQIHTGNVLEVLDHMGSRQHMQ---QEQGECREPLAGLEQHQHSMAKQHRMPLLG 334
            +   + Q+     L  L     +Q  Q   Q+Q + ++P   + Q QH   +Q       
Sbjct: 1134 VNNHMQQLPMQTQLLALPTQQQQQQQQQQQQQQQQMQQPQMQISQQQHQQQQQTSQL--- 1190

Query: 333  QQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQ 205
            QQ+   L +QQ  Q++ Q  +QQ + H  Y   + +   Q+ Q
Sbjct: 1191 QQQPAQLQQQQPQQQQQQPIQQQQQHHPVYSNFQQQQQQQQQQ 1233


>AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,
            isoform C protein.
          Length = 5476

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3853 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3907

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3908 HGPQQQQKSPQGVGHLGG 3925


>AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,
            isoform B protein.
          Length = 5533

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3910 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3964

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3965 HGPQQQQKSPQGVGHLGG 3982


>AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,
            isoform A protein.
          Length = 5560

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 21/78 (26%), Positives = 37/78 (47%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            ++  H   +QH  Q+Q + ++    L Q QH   +Q       QQ+   L + QK+Q ++
Sbjct: 3910 QIQQHQSQQQHQVQQQNQAQQ--QHLSQQQHQSQQQLNQQHQAQQQ--QLQQIQKLQ-QM 3964

Query: 282  QL*EQQMELHRGYGRSEG 229
               +QQ +  +G G   G
Sbjct: 3965 HGPQQQQKSPQGVGHLGG 3982


>AE013599-3853|AAF47195.1|  449|Drosophila melanogaster CG3411-PA
           protein.
          Length = 449

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 28/93 (30%), Positives = 41/93 (44%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           +L +MG    MQ+       P A   Q  HS   QH      QQ+     +QQ+ Q++ Q
Sbjct: 45  LLQNMGGVPPMQRPNPAAGAPPAPQCQTLHS--PQHA----SQQQQQQQQQQQQHQQQQQ 98

Query: 279 L*EQQMELHRGYGRSEGRCCYQRTQCPAGDINL 181
             +Q  +  RG  RS G  CY+     +G + L
Sbjct: 99  QQQQHPQQQRGLKRS-GSDCYEDHHRSSGGLTL 130


>AE013599-3368|AAF46827.1| 1024|Drosophila melanogaster CG5799-PA,
           isoform A protein.
          Length = 1024

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = -1

Query: 396 LAGLEQHQHSMAK--QHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           +AG +QH+ S  +  Q ++  L  Q+  H  +QQ+ Q++ Q  +QQ + H
Sbjct: 80  VAGEDQHRRSSLQGVQEKLTQLQMQQQHHQQQQQQQQQQQQQHQQQQQHH 129


>Z50097-2|CAB58233.1| 1080|Drosophila melanogaster headcase protein
           protein.
          Length = 1080

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 15/56 (26%), Positives = 26/56 (46%)
 Frame = -1

Query: 453 DHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           D +G+  H QQ Q + R+     +Q Q    +Q +     QQ+     +QQ+ Q +
Sbjct: 713 DLIGAHPHAQQHQQQVRQQQQQQQQQQPQQQQQQQQQQTQQQQSQQQQQQQQQQHQ 768


>X59772-1|CAB36921.1|  850|Drosophila melanogaster ovo protein
           protein.
          Length = 850

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 611 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 655


>U33015-1|AAB38385.1|  454|Drosophila melanogaster Cdk8 protein.
          Length = 454

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     + +    AK+ R+   G Q+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 382 QQQQQQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQQQQQQQ 441

Query: 258 L 256
           +
Sbjct: 442 M 442


>U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa
           protein.
          Length = 1028

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 789 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 833


>BT022385-1|AAY54801.1|  124|Drosophila melanogaster IP05263p
           protein.
          Length = 124

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 22/67 (32%), Positives = 27/67 (40%), Gaps = 9/67 (13%)
 Frame = +2

Query: 266 CCSY--SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP-------C 418
           CC    SC+  C  C S     SCC      CC    C  C +P+  S  +P       C
Sbjct: 61  CCGPCGSCSNGCAACLS-----SCCGIFPETCC-GPWCESCLDPSWFSWLAPDLGRSCCC 114

Query: 419 SCCICCR 439
           +C  CCR
Sbjct: 115 ACMTCCR 121


>BT022159-1|AAY51785.1| 1224|Drosophila melanogaster IP01381p
           protein.
          Length = 1224

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = -1

Query: 570 LLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLA 391
           ++S +   VL++ ++AL +   I QT  Q  T         +      Q++Q E +    
Sbjct: 309 VISRSPMTVLNVVQQALPATQLILQTQQQ-QTPAAAAAEQQLALALEQQRQQQEQQAQQQ 367

Query: 390 GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR-VQL*EQQMELH 253
             +Q Q    +Q +     QQ+     EQQ+ Q++ +Q  +QQ + H
Sbjct: 368 RQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTH 414


>BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p
           protein.
          Length = 882

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           L+Q Q  M +QH++    QQ++ H   QQ+ Q + QL +QQ + H+
Sbjct: 210 LQQQQQHMLQQHQL----QQQLQH---QQQQQHQQQLQQQQQQHHQ 248


>BT009981-1|AAQ22450.1| 1281|Drosophila melanogaster RE54443p
           protein.
          Length = 1281

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = -1

Query: 570 LLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLA 391
           ++S +   VL++ ++AL +   I QT  Q  T         +      Q++Q E +    
Sbjct: 366 VISRSPMTVLNVVQQALPATQLILQTQQQ-QTPAAAAAEQQLALALEQQRQQQEQQAQQQ 424

Query: 390 GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR-VQL*EQQMELH 253
             +Q Q    +Q +     QQ+     EQQ+ Q++ +Q  +QQ + H
Sbjct: 425 RQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTH 471


>AY119649-1|AAM50303.1|  975|Drosophila melanogaster RE46053p
           protein.
          Length = 975

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 736 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 780


>AY119554-1|AAM50208.1| 1054|Drosophila melanogaster GH28348p
           protein.
          Length = 1054

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPL-AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q+    Q + + P  +G  Q   S  +Q  +    QQ+   LL+QQ++Q++ QL +Q  
Sbjct: 649 KQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQ 708

Query: 261 ELHR 250
            L +
Sbjct: 709 GLQQ 712


>AY119111-1|AAM50971.1|  454|Drosophila melanogaster RE13344p
           protein.
          Length = 454

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     + +    AK+ R+   G Q+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 382 QQQQQQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQQQQQQQ 441

Query: 258 L 256
           +
Sbjct: 442 M 442


>AY118284-1|AAM48313.1|  630|Drosophila melanogaster AT15314p
           protein.
          Length = 630

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/58 (27%), Positives = 31/58 (53%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           +QQ+  +   P+  ++  Q    + ++MP++ QQ+   +L QQ+ Q+  Q   QQ  L
Sbjct: 328 LQQQPPQQSLPMQTIQSQQQ---QHNQMPIISQQQQQQILMQQQQQQGSQQGSQQFNL 382


>AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p protein.
          Length = 1351

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387  LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 1112 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 1156


>AY089493-1|AAL90231.1|  734|Drosophila melanogaster GH05993p
           protein.
          Length = 734

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPL-AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q+    Q + + P  +G  Q   S  +Q  +    QQ+   LL+QQ++Q++ QL +Q  
Sbjct: 329 KQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQ 388

Query: 261 ELHR 250
            L +
Sbjct: 389 GLQQ 392


>AY060753-1|AAL28301.1|  271|Drosophila melanogaster GH20409p
           protein.
          Length = 271

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 11/38 (28%), Positives = 20/38 (52%)
 Frame = +2

Query: 308 SNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           S+   ++CC     +CC+     CC++P +  +  PCS
Sbjct: 95  SSSAWSTCCSKPSTICCYPKPTRCCASPKAPLV--PCS 130


>AY058706-1|AAL13935.1| 1556|Drosophila melanogaster LD43050p protein.
          Length = 1556

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 20/80 (25%), Positives = 37/80 (46%)
 Frame = -1

Query: 579  QYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECRE 400
            Q+ ++S   S    + R  L   +S+E+ + + +   V  +L     +Q  QQ+Q +  +
Sbjct: 794  QHAIVSKPLSAERGIMRGVLTP-NSLEKNIFRYNDPTVNGLLQQQQQQQQQQQQQQQQHQ 852

Query: 399  PLAGLEQHQHSMAKQHRMPL 340
             L   +QH H     H+ PL
Sbjct: 853  QL---QQHGHQQQPHHQHPL 869


>AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein
            protein.
          Length = 1222

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387  LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 983  LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 1027


>AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby
            protein.
          Length = 1354

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387  LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 1115 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 1159


>AF088274-1|AAD39717.1|  103|Drosophila melanogaster Suppressor of
           Hairless protein.
          Length = 103

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -1

Query: 432 HMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           H QQ+Q     P  GL   Q   ++Q +  L    +V H  +QQ+ Q++ Q  +QQM++
Sbjct: 10  HQQQQQQSQDMPHFGLPGPQPPSSQQQQQQL----QVHHQQQQQQQQQQQQQHQQQMQM 64


>AE014298-2605|AAF48759.2| 1556|Drosophila melanogaster CG32560-PA
            protein.
          Length = 1556

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 20/80 (25%), Positives = 37/80 (46%)
 Frame = -1

Query: 579  QYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECRE 400
            Q+ ++S   S    + R  L   +S+E+ + + +   V  +L     +Q  QQ+Q +  +
Sbjct: 794  QHAIVSKPLSAERGIMRGVLTP-NSLEKNIFRYNDPTVNGLLQQQQQQQQQQQQQQQQHQ 852

Query: 399  PLAGLEQHQHSMAKQHRMPL 340
             L   +QH H     H+ PL
Sbjct: 853  QL---QQHGHQQQPHHQHPL 869


>AE014298-704|AAS65261.1| 1281|Drosophila melanogaster CG32767-PB,
           isoform B protein.
          Length = 1281

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = -1

Query: 570 LLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLA 391
           ++S +   VL++ ++AL +   I QT  Q  T         +      Q++Q E +    
Sbjct: 366 VISRSPMTVLNVVQQALPATQLILQTQQQ-QTPAAAAAEQQLALALEQQRQQQEQQAQQQ 424

Query: 390 GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR-VQL*EQQMELH 253
             +Q Q    +Q +     QQ+     EQQ+ Q++ +Q  +QQ + H
Sbjct: 425 RQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTH 471


>AE014298-703|AAF46005.2| 1281|Drosophila melanogaster CG32767-PA,
           isoform A protein.
          Length = 1281

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = -1

Query: 570 LLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLA 391
           ++S +   VL++ ++AL +   I QT  Q  T         +      Q++Q E +    
Sbjct: 366 VISRSPMTVLNVVQQALPATQLILQTQQQ-QTPAAAAAEQQLALALEQQRQQQEQQAQQQ 424

Query: 390 GLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR-VQL*EQQMELH 253
             +Q Q    +Q +     QQ+     EQQ+ Q++ +Q  +QQ + H
Sbjct: 425 RQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTH 471


>AE014298-702|AAF46002.2|  975|Drosophila melanogaster CG6824-PA,
           isoform A protein.
          Length = 975

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 736 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 780


>AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,
           isoform D protein.
          Length = 1028

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 789 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 833


>AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,
            isoform C protein.
          Length = 1222

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387  LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 983  LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 1027


>AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,
            isoform B protein.
          Length = 1351

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 387  LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            L +H H    Q +     QQ +   ++QQ VQ++  L +QQ + H
Sbjct: 1112 LSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQH 1156


>AE014297-4575|AAO41615.1| 1080|Drosophila melanogaster CG15532-PC,
           isoform C protein.
          Length = 1080

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 15/56 (26%), Positives = 26/56 (46%)
 Frame = -1

Query: 453 DHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           D +G+  H QQ Q + R+     +Q Q    +Q +     QQ+     +QQ+ Q +
Sbjct: 714 DLIGAHPHAQQHQQQVRQQQQQQQQQQPQQQQQQQQQQTQQQQSQQQQQQQQQQHQ 769


>AE014297-3885|AAF56538.1|  613|Drosophila melanogaster CG14540-PA
           protein.
          Length = 613

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           Q+H    +   +H+   +H QQ++ +  +P     QHQH     H+  + G+Q VP
Sbjct: 230 QLHQQQQMTTHNHL---KHQQQQRLQHSQP----HQHQHQHPHPHQKQMRGRQPVP 278


>AE014297-2619|AAF55629.2| 1542|Drosophila melanogaster CG6026-PA
           protein.
          Length = 1542

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 21/83 (25%), Positives = 44/83 (53%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           EQ  +Q+     ++    +  +Q+ +Q+Q +  E     +Q+Q  + KQH    L +Q+ 
Sbjct: 375 EQQQLQLEKQQQMQKQQQIQHQQYQEQQQQQLYEQ----QQYQLQLEKQH----LDKQKH 426

Query: 321 PHLLEQQKVQRRVQL*EQQMELH 253
           P+   QQ+++++ Q  +QQ + H
Sbjct: 427 PY---QQQLEKQQQQQQQQQQQH 446


>AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA
           protein.
          Length = 943

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           L+Q Q  M +QH++    QQ++ H   QQ+ Q + QL +QQ + H+
Sbjct: 271 LQQQQQHMLQQHQL----QQQLQH---QQQQQHQQQLQQQQQQHHQ 309


>AE014297-95|AAF52123.1|  970|Drosophila melanogaster CG14650-PA
           protein.
          Length = 970

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = -1

Query: 480 HTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHL 313
           HT  V   L H   +Q  QQ Q + +  L  + Q QH  A    +PL+     PHL
Sbjct: 24  HTDEVGNYLAHQQQQQQQQQHQHQTQNYL--IHQQQHGQAP---VPLMWPPPPPHL 74


>AE014296-3573|AAF51744.3| 2352|Drosophila melanogaster CG7177-PA
            protein.
          Length = 2352

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/58 (27%), Positives = 31/58 (53%)
 Frame = -1

Query: 429  MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
            +QQ+  +   P+  ++  Q    + ++MP++ QQ+   +L QQ+ Q+  Q   QQ  L
Sbjct: 2050 LQQQPPQQSLPMQTIQSQQQ---QHNQMPIISQQQQQQILMQQQQQQGSQQGSQQFNL 2104



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/41 (39%), Positives = 28/41 (68%), Gaps = 2/41 (4%)
 Frame = -1

Query: 381  QHQHSMAKQHRMPLLGQQEVPHLLEQQK--VQRRVQL*EQQ 265
            Q Q +M++Q + PL+ QQ++P L++QQ   VQ++  L + Q
Sbjct: 1213 QQQQAMSQQQQQPLVQQQQLP-LVQQQPPLVQQQQPLVQHQ 1252


>AE014296-1760|AAF50197.2|  454|Drosophila melanogaster CG10572-PA
           protein.
          Length = 454

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     + +    AK+ R+   G Q+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 382 QQQQQQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQQQQQQQ 441

Query: 258 L 256
           +
Sbjct: 442 M 442


>AE014296-1713|AAF50220.2| 1473|Drosophila melanogaster CG16711-PA,
            isoform A protein.
          Length = 1473

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 16/68 (23%), Positives = 33/68 (48%)
 Frame = -1

Query: 453  DHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
            ++M  + + QQ Q    +     +QHQ    +QH+     QQ+     + Q+ Q++ +  
Sbjct: 1333 NYMAEQSYWQQHQQHHHQQQQQ-QQHQQQQQQQHQQQQHQQQQQHQQQQHQQQQQQQKQL 1391

Query: 273  EQQMELHR 250
            +QQ + H+
Sbjct: 1392 QQQQQQHQ 1399



 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH Q    + ++     +Q Q    +QH+     QQ+  H  +QQ+ Q+++Q  +QQ +
Sbjct: 1342 QQHQQHHHQQQQQQQHQQQQQQQHQQQQHQQQQQHQQQ-QH-QQQQQQQKQLQQQQQQHQ 1399

Query: 258  LHRGYGRSEGR 226
                 G S  R
Sbjct: 1400 WSANNGSSNQR 1410


>AE014134-1654|AAF52786.2| 1054|Drosophila melanogaster CG4405-PB,
           isoform B protein.
          Length = 1054

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPL-AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q+    Q + + P  +G  Q   S  +Q  +    QQ+   LL+QQ++Q++ QL +Q  
Sbjct: 649 KQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQ 708

Query: 261 ELHR 250
            L +
Sbjct: 709 GLQQ 712


>AE014134-1653|AAF52787.2| 1054|Drosophila melanogaster CG4405-PA,
           isoform A protein.
          Length = 1054

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPL-AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q+    Q + + P  +G  Q   S  +Q  +    QQ+   LL+QQ++Q++ QL +Q  
Sbjct: 649 KQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQ 708

Query: 261 ELHR 250
            L +
Sbjct: 709 GLQQ 712


>AE014134-406|AAF51257.1|  271|Drosophila melanogaster CG3557-PA
           protein.
          Length = 271

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 11/38 (28%), Positives = 20/38 (52%)
 Frame = +2

Query: 308 SNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           S+   ++CC     +CC+     CC++P +  +  PCS
Sbjct: 95  SSSAWSTCCSKPSTICCYPKPTRCCASPKAPLV--PCS 130


>AB069908-1|BAB62875.1| 1054|Drosophila melanogaster junctophilin
           protein.
          Length = 1054

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPL-AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q+    Q + + P  +G  Q   S  +Q  +    QQ+   LL+QQ++Q++ QL +Q  
Sbjct: 649 KQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQ 708

Query: 261 ELHR 250
            L +
Sbjct: 709 GLQQ 712


>X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protein
           protein.
          Length = 1596

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
           L  +  +Q MQQ+Q +        + HQ    K   +P   +Q+    + QQ++Q++ Q 
Sbjct: 755 LKRLQQQQAMQQQQQQ--------QHHQQQQPKMGGVPNFNKQQQQQQVPQQQLQQQQQQ 806

Query: 276 *EQQMELHRGY 244
            +QQ +  + Y
Sbjct: 807 QQQQQQQQQQY 817


>BT029620-1|ABL75679.1|  127|Drosophila melanogaster IP17106p
           protein.
          Length = 127

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 9/69 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-----CTFCCSNRCGTSCCPSSGILC----CFAILCWCCSNPASGSL 406
           C S C   SC        C   C   CG SC  SSG  C    C A++ +  +    G L
Sbjct: 28  CGSCCVGGSCCRGGTGGCCGGSCGGSCGGSCGGSSGGCCGPPPC-AVVSYRLTYGPVGPL 86

Query: 407 HSPCSCCIC 433
             PC  C C
Sbjct: 87  -LPCMKCTC 94


>BT029556-1|ABL75616.1|  127|Drosophila melanogaster IP16806p
           protein.
          Length = 127

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 9/69 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-----CTFCCSNRCGTSCCPSSGILC----CFAILCWCCSNPASGSL 406
           C S C   SC        C   C   CG SC  SSG  C    C A++ +  +    G L
Sbjct: 28  CGSCCVGGSCCRGGTGGCCGGSCGGSCGGSCGGSSGGCCGPPPC-AVVSYRLTYGPVGPL 86

Query: 407 HSPCSCCIC 433
             PC  C C
Sbjct: 87  -LPCMKCTC 94


>BT022130-1|AAY51525.1|  530|Drosophila melanogaster IP08855p
           protein.
          Length = 530

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 19/77 (24%), Positives = 36/77 (46%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           +S+ Q +V   T   L+  + + S Q   Q+Q + ++     +Q Q    +QH + +  Q
Sbjct: 453 TSMLQPVVTEATTAALQHANQLASAQQQLQQQQQQQQQ----QQQQQQQQQQHHIVITQQ 508

Query: 330 QEVPHLLEQQKVQRRVQ 280
           Q  P   +Q   Q++ Q
Sbjct: 509 QATPQQQQQTSQQQQQQ 525


>AY971884-1|AAX73355.1| 1518|Drosophila melanogaster hormone
           receptor 4 protein.
          Length = 1518

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = -1

Query: 483 IHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQ 304
           IH  ++L          H QQ+Q +   P + +   +     Q  +    QQ+ P L   
Sbjct: 498 IHLHHLLGQQQQQQQASHPQQQQQQQHSPHSLVRVKKEPNVGQRHLSPHHQQQSPLLQHH 557

Query: 303 QKVQRRVQL*EQQMELHR 250
           Q+ Q++ Q  +QQ  LH+
Sbjct: 558 QQQQQQQQ--QQQQHLHQ 573


>AY484701-1|AAR85347.1|  881|Drosophila melanogaster dysfusion
           protein.
          Length = 881

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR-MPLLGQ 331
           +++Q   Q H     + L H+   Q  QQ+  + ++     + H H   +QH   P + Q
Sbjct: 21  ALQQQQQQQHPHQQQQHLQHVLQLQQQQQQHLQQQQHHLQHQMHTHHNFQQHETSPTVSQ 80

Query: 330 QEVPHLLEQQKVQRRVQL*EQQME 259
           Q+  H+ +QQ    + Q   QQ +
Sbjct: 81  QQ--HMQQQQPQTTQQQHATQQQQ 102


>AY089604-1|AAL90342.1|  742|Drosophila melanogaster RE19838p
           protein.
          Length = 742

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 15/54 (27%), Positives = 32/54 (59%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +QQ+Q + R+P+    Q QH + +Q R P+  QQ++  + +Q +  ++  + +Q
Sbjct: 535 LQQQQQQQRQPVL---QQQHQLVQQQRQPV--QQQLSFISQQYQQPQQQSIYQQ 583


>AL035245-2|CAA22836.1| 1464|Drosophila melanogaster EG:133E12.2
           protein.
          Length = 1464

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = -1

Query: 483 IHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQ 304
           IH  ++L          H QQ+Q +   P + +   +     Q  +    QQ+ P L   
Sbjct: 443 IHLHHLLGQQQQQQQASHPQQQQQQQHSPHSLVRVKKEPNVGQRHLSPHHQQQSPLLQHH 502

Query: 303 QKVQRRVQL*EQQMELHR 250
           Q+ Q++ Q  +QQ  LH+
Sbjct: 503 QQQQQQQQ--QQQQHLHQ 518


>AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA
            protein.
          Length = 2090

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 1/79 (1%)
 Frame = -1

Query: 486  QIHTGNVLEVLDHMG-SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL 310
            Q H     + L H    +QH QQ Q +        +Q  H   +QH      Q    H L
Sbjct: 966  QQHQQQHAQQLQHQQLQQQHAQQHQQQQHHLHQQHQQLHHDPQQQHPQYHPHQLHA-HAL 1024

Query: 309  EQQKVQRRVQL*EQQMELH 253
              Q+ Q++ Q  +QQ +LH
Sbjct: 1025 PHQQQQQQQQQQQQQQQLH 1043


>AE014298-1329|AAF46491.3| 1367|Drosophila melanogaster CG32705-PA
            protein.
          Length = 1367

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -1

Query: 435  QHMQQEQGECREPLAGLEQHQHSMAKQH-RMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            Q  QQ+Q       A   ++   +  QH + P + QQ+   LL+QQ+V  + Q  +Q ++
Sbjct: 969  QQQQQQQQAAAAAAAAYYEYTSGLPPQHPQAPSIQQQQQQLLLQQQRVLMQHQQQQQALQ 1028


>AE014298-306|ABC67166.1| 1518|Drosophila melanogaster CG16902-PC
           protein.
          Length = 1518

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = -1

Query: 483 IHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQ 304
           IH  ++L          H QQ+Q +   P + +   +     Q  +    QQ+ P L   
Sbjct: 498 IHLHHLLGQQQQQQQASHPQQQQQQQHSPHSLVRVKKEPNVGQRHLSPHHQQQSPLLQHH 557

Query: 303 QKVQRRVQL*EQQMELHR 250
           Q+ Q++ Q  +QQ  LH+
Sbjct: 558 QQQQQQQQ--QQQQHLHQ 573


>AE014297-3920|AAF56569.3|  881|Drosophila melanogaster CG32474-PA
           protein.
          Length = 881

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR-MPLLGQ 331
           +++Q   Q H     + L H+   Q  QQ+  + ++     + H H   +QH   P + Q
Sbjct: 21  ALQQQQQQQHPHQQQQHLQHVLQLQQQQQQHLQQQQHHLQHQMHTHHNFQQHETSPTVSQ 80

Query: 330 QEVPHLLEQQKVQRRVQL*EQQME 259
           Q+  H+ +QQ    + Q   QQ +
Sbjct: 81  QQ--HMQQQQPQTTQQQHATQQQQ 102


>AE014296-2419|AAS65007.1|  582|Drosophila melanogaster CG33261-PF,
           isoform F protein.
          Length = 582

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -1

Query: 525 ALCSFSSIEQ--TLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQH 352
           AL S  S+ Q  T+  +HT   ++V     ++Q  QQ+Q + +      +Q Q +M    
Sbjct: 395 ALSSSGSVPQVQTVQSLHTLQGVQVKKDPDAQQQQQQQQQQQQ------QQQQQAMTVSG 448

Query: 351 RMPLLGQQEVPHLLEQ-QKVQRRVQL*EQQMELHR 250
                 QQ+V  + +Q Q+ Q++ Q  +QQ++ H+
Sbjct: 449 ATGGQVQQQVQQVQQQVQQQQQQQQQQQQQLQHHQ 483


>AE014296-2418|AAF49709.1|  582|Drosophila melanogaster CG33261-PA,
           isoform A protein.
          Length = 582

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -1

Query: 525 ALCSFSSIEQ--TLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQH 352
           AL S  S+ Q  T+  +HT   ++V     ++Q  QQ+Q + +      +Q Q +M    
Sbjct: 395 ALSSSGSVPQVQTVQSLHTLQGVQVKKDPDAQQQQQQQQQQQQ------QQQQQAMTVSG 448

Query: 351 RMPLLGQQEVPHLLEQ-QKVQRRVQL*EQQMELHR 250
                 QQ+V  + +Q Q+ Q++ Q  +QQ++ H+
Sbjct: 449 ATGGQVQQQVQQVQQQVQQQQQQQQQQQQQLQHHQ 483


>AE014296-2417|ABC66143.1|  567|Drosophila melanogaster CG33261-PI,
           isoform I protein.
          Length = 567

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -1

Query: 525 ALCSFSSIEQ--TLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQH 352
           AL S  S+ Q  T+  +HT   ++V     ++Q  QQ+Q + +      +Q Q +M    
Sbjct: 395 ALSSSGSVPQVQTVQSLHTLQGVQVKKDPDAQQQQQQQQQQQQ------QQQQQAMTVSG 448

Query: 351 RMPLLGQQEVPHLLEQ-QKVQRRVQL*EQQMELHR 250
                 QQ+V  + +Q Q+ Q++ Q  +QQ++ H+
Sbjct: 449 ATGGQVQQQVQQVQQQVQQQQQQQQQQQQQLQHHQ 483


>AE014296-1982|AAF50042.1|  530|Drosophila melanogaster CG7368-PB
           protein.
          Length = 530

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 19/77 (24%), Positives = 36/77 (46%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           +S+ Q +V   T   L+  + + S Q   Q+Q + ++     +Q Q    +QH + +  Q
Sbjct: 453 TSMLQPVVTEATTAALQHANQLASAQQQLQQQQQQQQQ----QQQQQQQQQQHHIVITQQ 508

Query: 330 QEVPHLLEQQKVQRRVQ 280
           Q  P   +Q   Q++ Q
Sbjct: 509 QATPQQQQQTSQQQQQQ 525


>AE013599-2611|AAF57754.1| 1205|Drosophila melanogaster CG5756-PA,
            isoform A protein.
          Length = 1205

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 15/54 (27%), Positives = 32/54 (59%)
 Frame = -1

Query: 429  MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
            +QQ+Q + R+P+    Q QH + +Q R P+  QQ++  + +Q +  ++  + +Q
Sbjct: 998  LQQQQQQQRQPVL---QQQHQLVQQQRQPV--QQQLSFISQQYQQPQQQSIYQQ 1046


>AE013599-2610|AAM68174.2|  742|Drosophila melanogaster CG5756-PB,
           isoform B protein.
          Length = 742

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 15/54 (27%), Positives = 32/54 (59%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +QQ+Q + R+P+    Q QH + +Q R P+  QQ++  + +Q +  ++  + +Q
Sbjct: 535 LQQQQQQQRQPVL---QQQHQLVQQQRQPV--QQQLSFISQQYQQPQQQSIYQQ 583


>AB095028-1|BAE53416.1|  918|Drosophila melanogaster bHLH-PAS
           protein similar to humanNXF protein.
          Length = 918

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR-MPLLGQ 331
           +++Q   Q H     + L H+   Q  QQ+  + ++     + H H   +QH   P + Q
Sbjct: 57  ALQQQQQQQHPHQQQQHLQHVLQLQQQQQQHLQQQQHHLQHQMHTHHNFQQHETSPTVSQ 116

Query: 330 QEVPHLLEQQKVQRRVQL*EQQME 259
           Q+  H+ +QQ    + Q   QQ +
Sbjct: 117 QQ--HMQQQQPQTTQQQHATQQQQ 138


>X67703-4|CAA47940.1|   68|Drosophila melanogaster Mst84Dd protein.
          Length = 68

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICC 436
           C   C  CC   CG  C P     CC    C  C  P  G    PC  C  CC
Sbjct: 9   CCGPCGPCCGPCCGPCCGP-----CCGP--CGPCCGPC-GPRCGPCGPCGPCC 53


>M97196-2|AAA28395.1|  304|Drosophila melanogaster DNA-binding
           protein isoform II protein.
          Length = 304

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+    LEQQ+ + + Q  +QQ+  H+
Sbjct: 54  QAEHHHQQQHQQQQQQQQQQQESLEQQQREMQEQAQQQQVHHHQ 97


>M97196-1|AAA28396.1|  510|Drosophila melanogaster DNA-binding
           protein isoform I protein.
          Length = 510

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q +H   +QH+     QQ+    LEQQ+ + + Q  +QQ+  H+
Sbjct: 232 QAEHHHQQQHQQQQQQQQQQQESLEQQQREMQEQAQQQQVHHHQ 275


>BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p
           protein.
          Length = 1594

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 20/88 (22%), Positives = 37/88 (42%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           + +     +QH QQ+Q + +  + G+        KQ +     QQ+VP    QQ+ Q++ 
Sbjct: 757 QAMQQQQQQQHHQQQQQQQQPKMGGVPNFN----KQQQ-----QQQVPQQQLQQQQQQQQ 807

Query: 282 QL*EQQMELHRGYGRSEGRCCYQRTQCP 199
           Q  +QQ + +  +             CP
Sbjct: 808 QQQQQQQQQYSPFSNQNPNAAANFLNCP 835


>BT010315-1|AAQ23633.1| 1559|Drosophila melanogaster AT27514p protein.
          Length = 1559

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 10/87 (11%)
 Frame = -1

Query: 516  SFSSIEQTL-VQIHTGNVLEVLDHMGSRQHMQQEQGEC---REPLAGLEQHQH------S 367
            S +S+ +TL V +  G    +  ++ ++QH QQ+Q +    ++     ++HQ        
Sbjct: 1031 SSNSLGKTLPVALRNGTQQFLSPNLIAQQHQQQQQQQLEQHQQQATAQQKHQQIQQFALQ 1090

Query: 366  MAKQHRMPLLGQQEVPHLLEQQKVQRR 286
             A+ H+  LL Q    +LL+QQ+ Q++
Sbjct: 1091 QAQLHQRQLLAQAANNNLLQQQQQQQQ 1117


>BT001369-1|AAN71124.1|  347|Drosophila melanogaster AT30804p
           protein.
          Length = 347

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           +Q + Q   + +   A  +Q QH +  QH+ PL G    P
Sbjct: 234 QQQVIQPDAQMQNKYANQQQQQHQLQPQHQSPLNGYPSQP 273


>AY094737-1|AAM11090.1|  828|Drosophila melanogaster GH28553p
           protein.
          Length = 828

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%)
 Frame = -1

Query: 393 AGLEQHQ----HSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           A + QHQ    H    QH+ P   QQ   H   QQ  Q +  L +QQ +
Sbjct: 144 AAIPQHQAHQPHQQPHQHQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQ 192


>AY058607-1|AAL13836.1|  999|Drosophila melanogaster LD30037p
           protein.
          Length = 999

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSG 346
           CS S T   T  CS+   +S CP+SG
Sbjct: 309 CSSSATSSSTASCSSVASSSLCPASG 334


>AJ001164-1|CAA04568.1| 1668|Drosophila melanogaster Additional sex
            combs protein.
          Length = 1668

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 10/87 (11%)
 Frame = -1

Query: 516  SFSSIEQTL-VQIHTGNVLEVLDHMGSRQHMQQEQGEC---REPLAGLEQHQH------S 367
            S +S+ +TL V +  G    +  ++ ++QH QQ+Q +    ++     ++HQ        
Sbjct: 1032 SSNSLGKTLPVALRNGTQQFLSPNLIAQQHQQQQQQQLEQHQQQATAQQKHQQIQQFALQ 1091

Query: 366  MAKQHRMPLLGQQEVPHLLEQQKVQRR 286
             A+ H+  LL Q    +LL+QQ+ Q++
Sbjct: 1092 QAQLHQRQLLAQAANNNLLQQQQQQQQ 1118


>AF159852-1|AAD54965.1|  999|Drosophila melanogaster RNA-binding
           protein Smaug protein.
          Length = 999

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSG 346
           CS S T   T  CS+   +S CP+SG
Sbjct: 309 CSSSATSSSTASCSSVASSSLCPASG 334


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,778,220
Number of Sequences: 53049
Number of extensions: 533494
Number of successful extensions: 5985
Number of sequences better than 10.0: 265
Number of HSP's better than 10.0 without gapping: 3042
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5000
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2641708800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).