SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   194   8e-50
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   194   8e-50
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   194   8e-50
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   194   8e-50
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   194   8e-50
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   194   8e-50
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   194   8e-50
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   194   8e-50
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   194   8e-50
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   192   3e-49
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   192   3e-49
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   192   3e-49
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   192   4e-49
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   192   4e-49
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   192   4e-49
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   192   4e-49
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   192   4e-49
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   192   4e-49
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   190   1e-48
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   190   1e-48
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   190   1e-48
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    190   1e-48
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   190   1e-48
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   190   1e-48
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   190   1e-48
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   190   1e-48
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   146   2e-35
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   138   4e-33
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   138   4e-33
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   135   4e-32
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   135   5e-32
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   124   1e-28
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   124   1e-28
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   124   1e-28
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...   102   5e-22
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...   102   5e-22
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    99   6e-21
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    97   2e-20
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    97   2e-20
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    97   2e-20
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    84   2e-16
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    84   2e-16
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    57   2e-08
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    57   2e-08
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    38   0.015
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    38   0.015
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    38   0.015
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.56 
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   3.9  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   3.9  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   3.9  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   3.9  
AE014296-1901|AAF50098.3|  137|Drosophila melanogaster CG12522-P...    29   3.9  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   3.9  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   3.9  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   3.9  
BT011434-1|AAR99092.1|  765|Drosophila melanogaster RH61815p pro...    29   6.9  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   9.1  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   9.1  
BT029957-1|ABM92831.1| 1040|Drosophila melanogaster IP17501p pro...    28   9.1  
BT024224-1|ABC86286.1|  923|Drosophila melanogaster LP13067p pro...    28   9.1  
BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p pro...    28   9.1  
AY058771-1|AAL14000.1|  885|Drosophila melanogaster SD05329p pro...    28   9.1  
AY058514-1|AAL13743.1|  802|Drosophila melanogaster LD21715p pro...    28   9.1  
AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA...    28   9.1  
AE014296-3638|AAF51794.1|  885|Drosophila melanogaster CG7143-PA...    28   9.1  
AE014296-2416|AAF49712.1|  802|Drosophila melanogaster CG32145-P...    28   9.1  
AB049433-1|BAB15799.1|  885|Drosophila melanogaster dpol-eta pro...    28   9.1  
AB036766-1|BAB20905.1|  885|Drosophila melanogaster DNA polymera...    28   9.1  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  194 bits (473), Expect = 8e-50
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  192 bits (468), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  192 bits (468), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 46  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 105

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 106 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 157



 Score =  102 bits (244), Expect = 5e-22
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +1

Query: 118 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 46


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  192 bits (468), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  192 bits (467), Expect = 4e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  134 bits (323), Expect = 1e-31
 Identities = 61/62 (98%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  190 bits (464), Expect = 1e-48
 Identities = 90/112 (80%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G+ALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALP 173



 Score =  129 bits (311), Expect = 4e-30
 Identities = 57/62 (91%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  190 bits (464), Expect = 1e-48
 Identities = 90/112 (80%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G+ALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALP 173



 Score =  129 bits (311), Expect = 4e-30
 Identities = 57/62 (91%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  190 bits (464), Expect = 1e-48
 Identities = 90/112 (80%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G+ALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALP 173



 Score =  129 bits (311), Expect = 4e-30
 Identities = 57/62 (91%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  190 bits (464), Expect = 1e-48
 Identities = 90/112 (80%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G+ALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALP 173



 Score =  129 bits (311), Expect = 4e-30
 Identities = 57/62 (91%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  190 bits (463), Expect = 1e-48
 Identities = 89/112 (79%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  130 bits (314), Expect = 2e-30
 Identities = 59/62 (95%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  190 bits (463), Expect = 1e-48
 Identities = 89/112 (79%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  130 bits (314), Expect = 2e-30
 Identities = 59/62 (95%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  190 bits (463), Expect = 1e-48
 Identities = 89/112 (79%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  130 bits (314), Expect = 2e-30
 Identities = 59/62 (95%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  190 bits (463), Expect = 1e-48
 Identities = 89/112 (79%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  130 bits (314), Expect = 2e-30
 Identities = 59/62 (95%), Positives = 60/62 (96%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  146 bits (355), Expect = 2e-35
 Identities = 72/91 (79%), Positives = 73/91 (80%)
 Frame = +3

Query: 315 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 494
           MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLS
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLS 107

Query: 495 LYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           LYASG        S    S   P  +GYALP
Sbjct: 108 LYASGRTTGIVLDSGDGVSHTVPIYEGYALP 138



 Score =  105 bits (251), Expect = 7e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 213
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  138 bits (335), Expect = 4e-33
 Identities = 68/112 (60%), Positives = 79/112 (70%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT
Sbjct: 59  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMT 117

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +IMFE F  PA YVA+QAVLSLYA+G        S    +   P  +G+ALP
Sbjct: 118 EIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALP 169



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/56 (60%), Positives = 43/56 (76%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  K
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARK 59


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  138 bits (335), Expect = 4e-33
 Identities = 68/112 (60%), Positives = 79/112 (70%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT
Sbjct: 67  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMT 125

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +IMFE F  PA YVA+QAVLSLYA+G        S    +   P  +G+ALP
Sbjct: 126 EIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALP 177



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/56 (60%), Positives = 43/56 (76%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  K
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARK 67


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  135 bits (327), Expect = 4e-32
 Identities = 67/113 (59%), Positives = 78/113 (69%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           E+RGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKM
Sbjct: 66  EKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKM 124

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           T+IMFE F  PA YVA+QAVLSL  +G        S    +   P  +G+ALP
Sbjct: 125 TEIMFEHFQVPAFYVAVQAVLSLCTTGRTVGIVVDSGDGVTHTVPIYEGFALP 177



 Score = 74.9 bits (176), Expect = 8e-14
 Identities = 33/56 (58%), Positives = 42/56 (75%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    K
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEK 67


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  135 bits (326), Expect = 5e-32
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/23 (95%), Positives = 23/23 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDME 320
           +RGILTLKYPIEHGIVTNWDDME
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDME 84


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  124 bits (299), Expect = 1e-28
 Identities = 59/119 (49%), Positives = 82/119 (68%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             +  FE  N PA++V++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 26/52 (50%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAE 63


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  124 bits (299), Expect = 1e-28
 Identities = 59/119 (49%), Positives = 82/119 (68%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             +  FE  N PA++V++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 26/52 (50%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAE 63


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  124 bits (299), Expect = 1e-28
 Identities = 59/119 (49%), Positives = 82/119 (68%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             +  FE  N PA++V++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 26/52 (50%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAE 63


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score =  102 bits (244), Expect = 5e-22
 Identities = 48/115 (41%), Positives = 72/115 (62%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANRE 422
           ++ R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NRE
Sbjct: 62  SQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           KM ++MFE +   + Y+AIQAVL+LYA G+       S    +  CP  + +ALP
Sbjct: 122 KMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALP 176



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEA 61


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score =  102 bits (244), Expect = 5e-22
 Identities = 48/115 (41%), Positives = 72/115 (62%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANRE 422
           ++ R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NRE
Sbjct: 62  SQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           KM ++MFE +   + Y+AIQAVL+LYA G+       S    +  CP  + +ALP
Sbjct: 122 KMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALP 176



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEA 61


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 98.7 bits (235), Expect = 6e-21
 Identities = 46/115 (40%), Positives = 70/115 (60%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANRE 422
           ++ R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NRE
Sbjct: 63  SQLRSLLEVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 122

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           KM ++MFE +   + Y+AIQA  +LYA G+       S    +  CP  + +ALP
Sbjct: 123 KMIEVMFEKYGFDSAYIAIQAAWTLYAQGLISGVVIDSGDGVTHICPVYEEFALP 177



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEA 62


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 42/80 (52%), Positives = 55/80 (68%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 447 TFNTPAMYVAIQAVLSLYAS 506
           TFN P +Y+A+QAVL+L AS
Sbjct: 133 TFNVPGLYIAVQAVLALAAS 152



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66



 Score = 29.1 bits (62), Expect = 5.2
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV   +P+ E
Sbjct: 161 RTLTGIVVDSGDGVTDVIPVAE 182


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 42/80 (52%), Positives = 55/80 (68%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 447 TFNTPAMYVAIQAVLSLYAS 506
           TFN P +Y+A+QAVL+L AS
Sbjct: 133 TFNVPGLYIAVQAVLALAAS 152



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVVDSGDGVTHVIPVAE 182


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 42/80 (52%), Positives = 55/80 (68%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 447 TFNTPAMYVAIQAVLSLYAS 506
           TFN P +Y+A+QAVL+L AS
Sbjct: 133 TFNVPGLYIAVQAVLALAAS 152



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVVDSGDGVTHVIPVAE 182


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 39/113 (34%), Positives = 65/113 (57%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           T  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK
Sbjct: 81  TVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREK 140

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           +T++MFE +N PA ++   AVL+ ++SG        S    ++  P  +GY L
Sbjct: 141 LTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVL 193



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 39/113 (34%), Positives = 65/113 (57%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           T  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK
Sbjct: 81  TVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREK 140

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           +T++MFE +N PA ++   AVL+ ++SG        S    ++  P  +GY L
Sbjct: 141 LTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGATHTSAVPVHEGYVL 193



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 443
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 444 ETFNTPAMYVAIQAVLS 494
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 443
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 444 ETFNTPAMYVAIQAVLS 494
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 462 AMYVAIQAVLSLY 500
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 462 AMYVAIQAVLSLY 500
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 462 AMYVAIQAVLSLY 500
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.56
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGS 114
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165 PLDRGKAPPSGRDGRYGTEGL 227
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AE014296-1901|AAF50098.3|  137|Drosophila melanogaster CG12522-PA
           protein.
          Length = 137

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = -2

Query: 548 RHRRRSPARYRWYAGRVQREHGLDGDVHGGRV 453
           RHRRR     R   G ++R    DGD  GGRV
Sbjct: 88  RHRRRRIIIIRRVGGGLRRRRERDGDEDGGRV 119


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 165  PLDRGKAPPSGRDGRYGTEGL 227
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>BT011434-1|AAR99092.1|  765|Drosophila melanogaster RH61815p
           protein.
          Length = 765

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +2

Query: 359 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVR 508
           R RG P PA  G+ + +  + +     ++ +QH  H   HP R  A+ ++
Sbjct: 545 RARGQPQPAQGGAQRGESVRVQAVRQALQALQHPVHPPAHPQRHAALSLQ 594


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVD 105
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVD 105
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>BT029957-1|ABM92831.1| 1040|Drosophila melanogaster IP17501p
           protein.
          Length = 1040

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = -3

Query: 523 DTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASV 386
           D  G PD+YS +  WM  +   + +  ++I+        GLRG S+
Sbjct: 814 DVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESL 859


>BT024224-1|ABC86286.1|  923|Drosophila melanogaster LP13067p
           protein.
          Length = 923

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = -3

Query: 523 DTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASV 386
           D  G PD+YS +  WM  +   + +  ++I+        GLRG S+
Sbjct: 697 DVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESL 742


>BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p
           protein.
          Length = 1231

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -2

Query: 575 SFRKWARCGRHRRRSPARYRWYA-GR--VQREHGLDGDVHGGR 456
           S R  +R  RHR RSPA YR    GR    +E G      GGR
Sbjct: 480 STRSRSRSMRHRSRSPAHYRGRGRGREPASKERGSSSRDFGGR 522


>AY058771-1|AAL14000.1|  885|Drosophila melanogaster SD05329p
           protein.
          Length = 885

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +3

Query: 345 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVS 524
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L    +P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 525 C 527
           C
Sbjct: 708 C 708


>AY058514-1|AAL13743.1|  802|Drosophila melanogaster LD21715p
           protein.
          Length = 802

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = -3

Query: 523 DTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASV 386
           D  G PD+YS +  WM  +   + +  ++I+        GLRG S+
Sbjct: 576 DVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESL 621


>AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA
           protein.
          Length = 1231

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -2

Query: 575 SFRKWARCGRHRRRSPARYRWYA-GR--VQREHGLDGDVHGGR 456
           S R  +R  RHR RSPA YR    GR    +E G      GGR
Sbjct: 480 STRSRSRSMRHRSRSPAHYRGRGRGREPASKERGSSSRDFGGR 522


>AE014296-3638|AAF51794.1|  885|Drosophila melanogaster CG7143-PA
           protein.
          Length = 885

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +3

Query: 345 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVS 524
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L    +P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 525 C 527
           C
Sbjct: 708 C 708


>AE014296-2416|AAF49712.1|  802|Drosophila melanogaster CG32145-PA
           protein.
          Length = 802

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = -3

Query: 523 DTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASV 386
           D  G PD+YS +  WM  +   + +  ++I+        GLRG S+
Sbjct: 576 DVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESL 621


>AB049433-1|BAB15799.1|  885|Drosophila melanogaster dpol-eta
           protein.
          Length = 885

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +3

Query: 345 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVS 524
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L    +P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 525 C 527
           C
Sbjct: 708 C 708


>AB036766-1|BAB20905.1|  885|Drosophila melanogaster DNA polymerase
           eta protein.
          Length = 885

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +3

Query: 345 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVS 524
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L    +P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 525 C 527
           C
Sbjct: 708 C 708


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,671,726
Number of Sequences: 53049
Number of extensions: 876694
Number of successful extensions: 3256
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 2837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3204
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2621070450
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).