SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle...    30   2.0  
BT023409-1|AAY55825.1|  424|Drosophila melanogaster GH23935p pro...    30   2.0  
AE014297-1672|AAN13562.1|  556|Drosophila melanogaster CG9813-PE...    30   2.0  
AE014297-1671|AAN13561.1|  556|Drosophila melanogaster CG9813-PD...    30   2.0  
AE014297-1670|AAF54937.1|  556|Drosophila melanogaster CG9813-PB...    30   2.0  
AE014297-1669|AAN13560.1|  556|Drosophila melanogaster CG9813-PA...    30   2.0  
AE014297-1668|AAN13559.1|  424|Drosophila melanogaster CG9813-PF...    30   2.0  
AE014297-1667|AAN13558.1|  424|Drosophila melanogaster CG9813-PC...    30   2.0  
AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-P...    30   2.0  
AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA...    29   4.7  
AE014134-1297|AAF52529.1|  108|Drosophila melanogaster CG13791-P...    29   4.7  
AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-P...    29   4.7  
M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase p...    28   8.2  
AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p pro...    28   8.2  
AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA...    28   8.2  
AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB...    28   8.2  
AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA...    28   8.2  

>M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenless
            protein protein.
          Length = 1595

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285  ATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTP 398
            AT  V P+  +P+AS+  ++ PL  A    SPN+   P
Sbjct: 1458 ATDEVLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHP 1495


>BT023409-1|AAY55825.1|  424|Drosophila melanogaster GH23935p
           protein.
          Length = 424

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 214 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 256


>AE014297-1672|AAN13562.1|  556|Drosophila melanogaster CG9813-PE,
           isoform E protein.
          Length = 556

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 346 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 388


>AE014297-1671|AAN13561.1|  556|Drosophila melanogaster CG9813-PD,
           isoform D protein.
          Length = 556

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 346 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 388


>AE014297-1670|AAF54937.1|  556|Drosophila melanogaster CG9813-PB,
           isoform B protein.
          Length = 556

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 346 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 388


>AE014297-1669|AAN13560.1|  556|Drosophila melanogaster CG9813-PA,
           isoform A protein.
          Length = 556

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 346 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 388


>AE014297-1668|AAN13559.1|  424|Drosophila melanogaster CG9813-PF,
           isoform F protein.
          Length = 424

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 214 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 256


>AE014297-1667|AAN13558.1|  424|Drosophila melanogaster CG9813-PC,
           isoform C protein.
          Length = 424

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 216 RLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSS 344
           RL +E+ Q+S   RI P     N  +   P  +TP AST  ++
Sbjct: 214 RLGIEFLQRSYANRIFPEEVRQNQLKRHSPAITTPPASTTTTT 256


>AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-PA,
            isoform A protein.
          Length = 2190

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +3

Query: 243  SDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTAS 377
            SD + I   +  T  +++  P  +TP ++   SSQP+   E T S
Sbjct: 1630 SDTKNITSTTYSTGDSKSFQPTATTPDSTDRSSSQPITFPESTTS 1674


>AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA
            protein.
          Length = 4498

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +3

Query: 312  STPSASTMVSSQPLIMAE--GTASPNVTLTPQDLIYKKCLSELETLVMPDYRQNNRPY 479
            STPS     + +P ++    G ASPN+TL P    Y++          P    NNR Y
Sbjct: 3714 STPSNRFGTTKRPRVVNRPPGVASPNLTLKPVASDYERTTPLTPLKPAPFIPSNNRSY 3771


>AE014134-1297|AAF52529.1|  108|Drosophila melanogaster CG13791-PA
           protein.
          Length = 108

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 224 SGVLPKVRLQKNNAEFRRYKCNTSCISG 307
           SG +P +R  ++ AE+RR+  N++ ISG
Sbjct: 46  SGKIPGLRKSESFAEYRRHSSNSATISG 73


>AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-PH,
            isoform H protein.
          Length = 8805

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +3

Query: 414  KKCLSELETLVMPDYRQNNRPYSDVRCRENYCFAEATNTSAISGERMRIQSFQHPLLR 587
            KK L  +E +V   Y + +  + D +  E   FAEA NT+ +    ++I+ F+  L +
Sbjct: 4212 KKPLRLIEAVVKNVYDEVDGHFVDPKSGEKLNFAEALNTNLLDEHSVQIRDFKTGLYK 4269


>M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase
           protein.
          Length = 459

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -1

Query: 219 IVFCNFSSRPLLQS*KVSRLFNCC--AHGKRHQNKREQV 109
           I+FCN + R  L + K++ L  CC   H K  Q  R +V
Sbjct: 299 IIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRV 337


>AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p
           protein.
          Length = 459

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -1

Query: 219 IVFCNFSSRPLLQS*KVSRLFNCC--AHGKRHQNKREQV 109
           I+FCN + R  L + K++ L  CC   H K  Q  R +V
Sbjct: 299 IIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRV 337


>AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA
           protein.
          Length = 1801

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 7/106 (6%)
 Frame = +3

Query: 168 KPFNFEEADEKKNCRRRLDLEYYQKSDCRRIMPNSEGTNATQA---VFPVRSTPS---AS 329
           K  + EEA+EK   +R+ +  +Y  S  R     SEGTN T A      + S P    ++
Sbjct: 251 KSSDLEEAEEKTYLKRQSERNFY--SGYR---SESEGTNITPAKRSKAQINSIPKLEYST 305

Query: 330 TMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLS-ELETLVMPDYRQ 464
           T   +Q L+++E   + N+T  P   I  +  S E   +  PD +Q
Sbjct: 306 TYGQAQNLVVSE---NANITQKPSSDIKSRYRSTEYNQINKPDSQQ 348


>AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB,
           isoform B protein.
          Length = 428

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -1

Query: 219 IVFCNFSSRPLLQS*KVSRLFNCC--AHGKRHQNKREQV 109
           I+FCN + R  L + K++ L  CC   H K  Q  R +V
Sbjct: 268 IIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRV 306


>AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA,
           isoform A protein.
          Length = 459

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -1

Query: 219 IVFCNFSSRPLLQS*KVSRLFNCC--AHGKRHQNKREQV 109
           I+FCN + R  L + K++ L  CC   H K  Q  R +V
Sbjct: 299 IIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRV 337


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,450,014
Number of Sequences: 53049
Number of extensions: 549889
Number of successful extensions: 1614
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1538
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1614
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2358819486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).