SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089523-1|AAL90261.1|  143|Drosophila melanogaster GM14585p pro...   100   2e-21
AE013599-1845|AAF58277.2|  143|Drosophila melanogaster CG8415-PA...   100   2e-21
M19494-1|AAA28935.1|  140|Drosophila melanogaster protein ( D.me...    34   0.10 
BT015958-1|AAV36843.1|  140|Drosophila melanogaster RH56553p pro...    34   0.10 
AL133505-2|CAB65841.1|  140|Drosophila melanogaster EG:BACH59J11...    34   0.10 
AL133505-1|CAB63528.1|  154|Drosophila melanogaster EG:BACH59J11...    34   0.10 
AE014298-399|AAF45781.1|  140|Drosophila melanogaster CG7925-PB ...    34   0.10 
AJ250320-1|CAB65721.1|  140|Drosophila melanogaster technical kn...    31   0.74 
BT021441-1|AAX33589.1|  491|Drosophila melanogaster GH03493p pro...    29   3.9  
AE014134-3080|AAN11036.1|  491|Drosophila melanogaster CG31798-P...    29   3.9  
BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p pro...    29   5.2  
AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p pro...    29   5.2  
AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC...    29   5.2  
AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB...    29   5.2  
AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA...    29   5.2  
AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypept...    29   5.2  
BT023494-1|AAY84894.1|  807|Drosophila melanogaster RE05457p pro...    28   9.1  
BT016008-1|AAV36893.1|  845|Drosophila melanogaster RE29310p pro...    28   9.1  
AY069201-1|AAL39346.2|  535|Drosophila melanogaster GH25723p pro...    28   9.1  
AJ002056-1|CAA05160.1|  845|Drosophila melanogaster D19A protein.      28   9.1  
AE014296-1094|AAF50677.2|  845|Drosophila melanogaster CG10269-P...    28   9.1  

>AY089523-1|AAL90261.1|  143|Drosophila melanogaster GM14585p
           protein.
          Length = 143

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS
Sbjct: 96  ENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 42/48 (87%), Positives = 45/48 (93%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVPRDG LN+IE+
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEE 96


>AE013599-1845|AAF58277.2|  143|Drosophila melanogaster CG8415-PA
           protein.
          Length = 143

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS
Sbjct: 96  ENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 42/48 (87%), Positives = 45/48 (93%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVPRDG LN+IE+
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEE 96


>M19494-1|AAA28935.1|  140|Drosophila melanogaster protein (
           D.melanogaster tko (technical knockout) locus mRNA
           encoding tko gene product,complete cds. ).
          Length = 140

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>BT015958-1|AAV36843.1|  140|Drosophila melanogaster RH56553p
           protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AL133505-2|CAB65841.1|  140|Drosophila melanogaster
           EG:BACH59J11.1,FBgn0003714;tko protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AL133505-1|CAB63528.1|  154|Drosophila melanogaster
           EG:BACH59J11.1,FBgn0003714;tko protein.
          Length = 154

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 74  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 113


>AE014298-399|AAF45781.1|  140|Drosophila melanogaster CG7925-PB
           protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AJ250320-1|CAB65721.1|  140|Drosophila melanogaster technical
           knockout protein protein.
          Length = 140

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+    GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVR-HSTGKEMVAYIPGIG 99


>BT021441-1|AAX33589.1|  491|Drosophila melanogaster GH03493p
           protein.
          Length = 491

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +1

Query: 244 FVVFSMWFRQPSRGTNAVTFFPFLMSCTRTHLRMAELGCLASTPT 378
           + ++SM+     + T+A+ F    M   R H+  AE+G  A + T
Sbjct: 177 YYIYSMYLVNTGQRTSAINFLQIAMDLVRGHVWTAEVGMPAGSLT 221


>AE014134-3080|AAN11036.1|  491|Drosophila melanogaster CG31798-PA
           protein.
          Length = 491

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +1

Query: 244 FVVFSMWFRQPSRGTNAVTFFPFLMSCTRTHLRMAELGCLASTPT 378
           + ++SM+     + T+A+ F    M   R H+  AE+G  A + T
Sbjct: 177 YYIYSMYLVNTGQRTSAINFLQIAMDLVRGHVWTAEVGMPAGSLT 221


>BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p
           protein.
          Length = 507

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 332 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 369


>AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC,
           isoform C protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB,
           isoform B protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA,
           isoform A protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypeptide
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 97  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 213
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>BT023494-1|AAY84894.1|  807|Drosophila melanogaster RE05457p
           protein.
          Length = 807

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 152 RDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFFRC 262
           R  L TF  +K+  G++  A PLR  P T   + FRC
Sbjct: 313 RVRLLTFH-MKKVHGITKAAAPLRDFPCTECDTVFRC 348


>BT016008-1|AAV36893.1|  845|Drosophila melanogaster RE29310p
           protein.
          Length = 845

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 152 RDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFFRC 262
           R  L TF  +K+  G++  A PLR  P T   + FRC
Sbjct: 351 RVRLLTFH-MKKVHGITKAAAPLRDFPCTECDTVFRC 386


>AY069201-1|AAL39346.2|  535|Drosophila melanogaster GH25723p
           protein.
          Length = 535

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 152 RDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFFRC 262
           R  L TF  +K+  G++  A PLR  P T   + FRC
Sbjct: 41  RVRLLTFH-MKKVHGITKAAAPLRDFPCTECDTVFRC 76


>AJ002056-1|CAA05160.1|  845|Drosophila melanogaster D19A protein.
          Length = 845

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 152 RDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFFRC 262
           R  L TF  +K+  G++  A PLR  P T   + FRC
Sbjct: 351 RVRLLTFH-MKKVHGITKAAAPLRDFPCTECDTVFRC 386


>AE014296-1094|AAF50677.2|  845|Drosophila melanogaster CG10269-PA
           protein.
          Length = 845

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 152 RDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFFRC 262
           R  L TF  +K+  G++  A PLR  P T   + FRC
Sbjct: 351 RVRLLTFH-MKKVHGITKAAAPLRDFPCTECDTVFRC 386


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,370,140
Number of Sequences: 53049
Number of extensions: 520864
Number of successful extensions: 1545
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1331
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1545
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1991467008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).