SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052146-1|AAK93570.1| 1728|Drosophila melanogaster SD10541p pro...   124   3e-29
AF093637-1|AAC72365.1| 1750|Drosophila melanogaster SET domain b...   124   3e-29
AE014297-1382|AAF54700.3| 1993|Drosophila melanogaster CG6939-PA...   124   3e-29
AE014297-1381|AAN13531.2| 1973|Drosophila melanogaster CG6939-PB...   124   3e-29
AE014298-2522|AAF48698.1| 1247|Drosophila melanogaster CG5004-PA...    44   5e-05
AL031583-9|CAA20901.1| 1014|Drosophila melanogaster EG:34F3.2 pr...    40   9e-04
AE014298-113|AAF45555.2| 1561|Drosophila melanogaster CG12467-PA...    40   9e-04
AY071322-1|AAL48944.1|  410|Drosophila melanogaster RE34385p pro...    39   0.003
AE014134-3539|ABI31329.1|  488|Drosophila melanogaster CG11628-P...    39   0.003
AE014134-3538|AAF57230.2|  410|Drosophila melanogaster CG11628-P...    39   0.003
AY069846-1|AAL39991.1|  760|Drosophila melanogaster SD09318p pro...    35   0.033
AJ012609-1|CAA10073.1|  954|Drosophila melanogaster RasGap prote...    35   0.033
AE014298-2320|AAS65383.1|  954|Drosophila melanogaster CG9209-PD...    35   0.033
AE014298-2319|AAN09380.1|  954|Drosophila melanogaster CG9209-PC...    35   0.033
AE014298-2318|AAF48558.2|  954|Drosophila melanogaster CG9209-PB...    35   0.033
AE014298-2317|AAN09381.2|  954|Drosophila melanogaster CG9209-PA...    35   0.033
BT001846-1|AAN71607.1|  285|Drosophila melanogaster RH55218p pro...    33   0.10 
AY061117-1|AAL28665.1|  224|Drosophila melanogaster LD10220p pro...    33   0.10 
AE014296-171|AAN11458.1|  224|Drosophila melanogaster CG9205-PB,...    33   0.10 
AE014296-170|AAF47437.1|  224|Drosophila melanogaster CG9205-PA,...    33   0.10 
Z26242-1|CAA81204.1|  530|Drosophila melanogaster Dakt1 serine-t...    33   0.13 
X83510-2|CAA58500.1|  530|Drosophila melanogaster RAC protein ki...    33   0.13 
X83510-1|CAA58499.2|  611|Drosophila melanogaster RAC protein ki...    33   0.13 
AY069856-1|AAL40001.1|  530|Drosophila melanogaster SD10374p pro...    33   0.13 
AE014297-2153|AAF55276.1|  530|Drosophila melanogaster CG4006-PB...    33   0.13 
AE014297-2152|AAF55275.1|  530|Drosophila melanogaster CG4006-PA...    33   0.13 
AE014297-2151|AAN13699.3|  611|Drosophila melanogaster CG4006-PC...    33   0.13 
Y13951-1|CAA74289.1|  784|Drosophila melanogaster oxysterol bind...    32   0.31 
AY129448-1|AAM76190.1|  784|Drosophila melanogaster LD31802p pro...    32   0.31 
AE014297-3675|AAF56371.1|  784|Drosophila melanogaster CG6708-PA...    32   0.31 
AE013599-961|AAF58878.3|  779|Drosophila melanogaster CG1513-PA ...    31   0.41 
BT030131-1|ABN49270.1| 1374|Drosophila melanogaster IP15972p pro...    31   0.54 
AE014297-1753|AAF54983.1|  776|Drosophila melanogaster CG14366-P...    31   0.54 
AE014134-2505|AAN10878.2| 1373|Drosophila melanogaster CG3479-PB...    31   0.54 
AE014134-2504|AAF53402.3| 1553|Drosophila melanogaster CG3479-PA...    31   0.54 
X97447-1|CAA66076.1|  878|Drosophila melanogaster Dos protein pr...    29   2.9  
AE014296-478|AAF47662.1|  878|Drosophila melanogaster CG1044-PA,...    29   2.9  
Z46790-1|CAA86754.1|   85|Drosophila melanogaster male germ-line...    28   5.1  
BT023108-1|AAY55524.1|  426|Drosophila melanogaster IP03717p pro...    28   5.1  
BT023088-1|AAY55504.1|  882|Drosophila melanogaster IP03817p pro...    28   5.1  
BT023069-1|AAY55485.1|  882|Drosophila melanogaster IP03917p pro...    28   5.1  
AE014134-2953|AAN11009.1|  838|Drosophila melanogaster CG31791-P...    28   5.1  
AE014134-807|AAF50958.1|  846|Drosophila melanogaster CG15624-PA...    28   5.1  
AF145644-1|AAD38619.1|  601|Drosophila melanogaster BcDNA.GH0768...    27   6.7  
AE014296-1410|AAF50454.1|  601|Drosophila melanogaster CG7207-PA...    27   6.7  
BT009929-1|AAQ22398.1| 1936|Drosophila melanogaster SD16537p pro...    27   8.9  
AE014298-2825|AAF48942.2| 1936|Drosophila melanogaster CG8002-PA...    27   8.9  

>AY052146-1|AAK93570.1| 1728|Drosophila melanogaster SD10541p protein.
          Length = 1728

 Score =  124 bits (300), Expect = 3e-29
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1629 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1688

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1689 KGVDEKGFFDLKTSKRIYNFYA 1710


>AF093637-1|AAC72365.1| 1750|Drosophila melanogaster SET domain
            binding factor protein.
          Length = 1750

 Score =  124 bits (300), Expect = 3e-29
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1651 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1710

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1711 KGVDEKGFFDLKTSKRIYNFYA 1732


>AE014297-1382|AAF54700.3| 1993|Drosophila melanogaster CG6939-PA,
            isoform A protein.
          Length = 1993

 Score =  124 bits (300), Expect = 3e-29
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1894 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1953

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1954 KGVDEKGFFDLKTSKRIYNFYA 1975


>AE014297-1381|AAN13531.2| 1973|Drosophila melanogaster CG6939-PB,
            isoform B protein.
          Length = 1973

 Score =  124 bits (300), Expect = 3e-29
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1874 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1933

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1934 KGVDEKGFFDLKTSKRIYNFYA 1955


>AE014298-2522|AAF48698.1| 1247|Drosophila melanogaster CG5004-PA
            protein.
          Length = 1247

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = -3

Query: 262  NARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG---FIDLAEVIAVTQAT 92
            + RG+L+K GA    W +RWFVLD  +  L YY    +   +G   F  + EV       
Sbjct: 1142 SCRGYLHKLGATFHAWSRRWFVLDRQRSALIYYSDKSERKPRGGAYFATIDEVYLDHLNA 1201

Query: 91   PAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
               G P  C     F ++T +R+YN  A+
Sbjct: 1202 SKSGRP-HCT----FIVKTKKRSYNLQAA 1225


>AL031583-9|CAA20901.1| 1014|Drosophila melanogaster EG:34F3.2
           protein.
          Length = 1014

 Score = 40.3 bits (90), Expect = 9e-04
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAVTQATPA 86
           GHL K G  LK W++RWFVL +    L Y+ +  D   K  G I L EV  + +A  A
Sbjct: 140 GHLAKLGGKLKTWRKRWFVLKN--GSLNYWKSQHDVQRKPQGQIQLDEVCRINRAEGA 195


>AE014298-113|AAF45555.2| 1561|Drosophila melanogaster CG12467-PA
           protein.
          Length = 1561

 Score = 40.3 bits (90), Expect = 9e-04
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAVTQATPA 86
           GHL K G  LK W++RWFVL +    L Y+ +  D   K  G I L EV  + +A  A
Sbjct: 655 GHLAKLGGKLKTWRKRWFVLKN--GSLNYWKSQHDVQRKPQGQIQLDEVCRINRAEGA 710


>AY071322-1|AAL48944.1|  410|Drosophila melanogaster RE34385p
           protein.
          Length = 410

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           G L+K+G   K WK+RWF+L+   + L Y++   D   +G I L  +
Sbjct: 281 GWLWKQGGRYKSWKRRWFILND--NCLYYFEYTTDKEPRGIIPLENI 325


>AE014134-3539|ABI31329.1|  488|Drosophila melanogaster CG11628-PB,
           isoform B protein.
          Length = 488

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           G L+K+G   K WK+RWF+L+   + L Y++   D   +G I L  +
Sbjct: 359 GWLWKQGGRYKSWKRRWFILND--NCLYYFEYTTDKEPRGIIPLENI 403


>AE014134-3538|AAF57230.2|  410|Drosophila melanogaster CG11628-PA,
           isoform A protein.
          Length = 410

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           G L+K+G   K WK+RWF+L+   + L Y++   D   +G I L  +
Sbjct: 281 GWLWKQGGRYKSWKRRWFILND--NCLYYFEYTTDKEPRGIIPLENI 325


>AY069846-1|AAL39991.1|  760|Drosophila melanogaster SD09318p
           protein.
          Length = 760

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 191 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 237


>AJ012609-1|CAA10073.1|  954|Drosophila melanogaster RasGap protein
           protein.
          Length = 954

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>AE014298-2320|AAS65383.1|  954|Drosophila melanogaster CG9209-PD,
           isoform D protein.
          Length = 954

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>AE014298-2319|AAN09380.1|  954|Drosophila melanogaster CG9209-PC,
           isoform C protein.
          Length = 954

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>AE014298-2318|AAF48558.2|  954|Drosophila melanogaster CG9209-PB,
           isoform B protein.
          Length = 954

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>AE014298-2317|AAN09381.2|  954|Drosophila melanogaster CG9209-PA,
           isoform A protein.
          Length = 954

 Score = 35.1 bits (77), Expect = 0.033
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>BT001846-1|AAN71607.1|  285|Drosophila melanogaster RH55218p
           protein.
          Length = 285

 Score = 33.5 bits (73), Expect = 0.10
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWF +D+    L YY
Sbjct: 80  GQLSKYTNVMKGWQYRWFTVDAKTGSLSYY 109


>AY061117-1|AAL28665.1|  224|Drosophila melanogaster LD10220p
           protein.
          Length = 224

 Score = 33.5 bits (73), Expect = 0.10
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWF +D+    L YY
Sbjct: 19  GQLSKYTNVMKGWQYRWFTVDAKTGSLSYY 48


>AE014296-171|AAN11458.1|  224|Drosophila melanogaster CG9205-PB,
           isoform B protein.
          Length = 224

 Score = 33.5 bits (73), Expect = 0.10
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWF +D+    L YY
Sbjct: 19  GQLSKYTNVMKGWQYRWFTVDAKTGSLSYY 48


>AE014296-170|AAF47437.1|  224|Drosophila melanogaster CG9205-PA,
           isoform A protein.
          Length = 224

 Score = 33.5 bits (73), Expect = 0.10
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWF +D+    L YY
Sbjct: 19  GQLSKYTNVMKGWQYRWFTVDAKTGSLSYY 48


>Z26242-1|CAA81204.1|  530|Drosophila melanogaster Dakt1
           serine-threonine proteinkinase protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 30  GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 65


>X83510-2|CAA58500.1|  530|Drosophila melanogaster RAC protein
           kinase DRAC-PK66 protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 30  GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 65


>X83510-1|CAA58499.2|  611|Drosophila melanogaster RAC protein
           kinase DRAC-PK85 protein.
          Length = 611

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 111 GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 146


>AY069856-1|AAL40001.1|  530|Drosophila melanogaster SD10374p
           protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 30  GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 65


>AE014297-2153|AAF55276.1|  530|Drosophila melanogaster CG4006-PB,
           isoform B protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 30  GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 65


>AE014297-2152|AAF55275.1|  530|Drosophila melanogaster CG4006-PA,
           isoform A protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 30  GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 65


>AE014297-2151|AAN13699.3|  611|Drosophila melanogaster CG4006-PC,
           isoform C protein.
          Length = 611

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 111 GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 146


>Y13951-1|CAA74289.1|  784|Drosophila melanogaster oxysterol binding
           protein homologueprotein.
          Length = 784

 Score = 31.9 bits (69), Expect = 0.31
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDL 122
           +G L K    +KG+++RWFVL   K  L YY +  E +H C+G I L
Sbjct: 18  KGWLLKWTNYIKGYQRRWFVLS--KGVLSYYRNQSEINHTCRGTISL 62


>AY129448-1|AAM76190.1|  784|Drosophila melanogaster LD31802p
           protein.
          Length = 784

 Score = 31.9 bits (69), Expect = 0.31
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDL 122
           +G L K    +KG+++RWFVL   K  L YY +  E +H C+G I L
Sbjct: 18  KGWLLKWTNYIKGYQRRWFVLS--KGVLSYYRNQSEINHTCRGTISL 62


>AE014297-3675|AAF56371.1|  784|Drosophila melanogaster CG6708-PA
           protein.
          Length = 784

 Score = 31.9 bits (69), Expect = 0.31
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDL 122
           +G L K    +KG+++RWFVL   K  L YY +  E +H C+G I L
Sbjct: 18  KGWLLKWTNYIKGYQRRWFVLS--KGVLSYYRNQSEINHTCRGTISL 62


>AE013599-961|AAF58878.3|  779|Drosophila melanogaster CG1513-PA
           protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 0.41
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G L K   ++KGW+ R+FVLD     L YY + +D   KG
Sbjct: 26  GTLSKWTNVMKGWQYRFFVLDENAGLLSYYTS-KDKMIKG 64


>BT030131-1|ABN49270.1| 1374|Drosophila melanogaster IP15972p
           protein.
          Length = 1374

 Score = 31.1 bits (67), Expect = 0.54
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           K W++RWFVL          D   ++  +  +D+ +V+ VT A    G P
Sbjct: 107 KRWQRRWFVLYDDGELTYSVDDYPETIPQACVDMTKVLEVTSAVEVTGHP 156


>AE014297-1753|AAF54983.1|  776|Drosophila melanogaster CG14366-PA
           protein.
          Length = 776

 Score = 31.1 bits (67), Expect = 0.54
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = -3

Query: 253 GHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G L+K+G+  LK W++RWFVL   ++ L YY   E+    G +
Sbjct: 376 GWLHKQGSDGLKVWRKRWFVL--AEYCLYYYKGPEEEKLLGSV 416


>AE014134-2505|AAN10878.2| 1373|Drosophila melanogaster CG3479-PB,
           isoform B protein.
          Length = 1373

 Score = 31.1 bits (67), Expect = 0.54
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           K W++RWFVL          D   ++  +  +D+ +V+ VT A    G P
Sbjct: 94  KRWQRRWFVLYDDGELTYSVDDYPETIPQACVDMTKVLEVTSAVEVTGHP 143


>AE014134-2504|AAF53402.3| 1553|Drosophila melanogaster CG3479-PA,
           isoform A protein.
          Length = 1553

 Score = 31.1 bits (67), Expect = 0.54
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           K W++RWFVL          D   ++  +  +D+ +V+ VT A    G P
Sbjct: 94  KRWQRRWFVLYDDGELTYSVDDYPETIPQACVDMTKVLEVTSAVEVTGHP 143


>X97447-1|CAA66076.1|  878|Drosophila melanogaster Dos protein
           protein.
          Length = 878

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
 Frame = -3

Query: 217 WKQRWFVLDS--IKHQ--LRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSF 50
           W++R+F L    I  Q  L YY        KG IDL +   V          +K   +  
Sbjct: 24  WRRRYFTLKQGEIPEQFCLEYYTDHNCRKLKGVIDLDQCEQVDCGLRLENRKQKF--QYM 81

Query: 49  FDLRTSRRTYNFCA 8
           FD++T +RTY   A
Sbjct: 82  FDIKTPKRTYYLAA 95


>AE014296-478|AAF47662.1|  878|Drosophila melanogaster CG1044-PA,
           isoform A protein.
          Length = 878

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
 Frame = -3

Query: 217 WKQRWFVLDS--IKHQ--LRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSF 50
           W++R+F L    I  Q  L YY        KG IDL +   V          +K   +  
Sbjct: 24  WRRRYFTLKQGEIPEQFCLEYYTDHNCRKLKGVIDLDQCEQVDCGLRLENRKQKF--QYM 81

Query: 49  FDLRTSRRTYNFCA 8
           FD++T +RTY   A
Sbjct: 82  FDIKTPKRTYYLAA 95


>Z46790-1|CAA86754.1|   85|Drosophila melanogaster male germ-line
           specific transcriptencoding putative protamine protein.
          Length = 85

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +3

Query: 207 LCFHPLSRAPRL*RC-PRAFCSRRRSTRTVHSIVERKTVAVPTLSC 341
           +C HP+ RAP+  +C P   C++ R  R        K    P   C
Sbjct: 7   MCNHPIRRAPQ--KCKPMKSCAKPRRKRACAKATRPKVKCAPRQKC 50


>BT023108-1|AAY55524.1|  426|Drosophila melanogaster IP03717p
           protein.
          Length = 426

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSI--KHQL 173
           +R +EQ  R  L+KRG LL  W     VL S+  KH L
Sbjct: 195 KRSKEQRQRDKLWKRGGLLVFWILSAVVLISVGEKHLL 232


>BT023088-1|AAY55504.1|  882|Drosophila melanogaster IP03817p
           protein.
          Length = 882

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSI--KHQL 173
           +R +EQ  R  L+KRG LL  W     VL S+  KH L
Sbjct: 196 KRSKEQRQRDKLWKRGGLLVFWILSAVVLISVGEKHLL 233


>BT023069-1|AAY55485.1|  882|Drosophila melanogaster IP03917p
           protein.
          Length = 882

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSI--KHQL 173
           +R +EQ  R  L+KRG LL  W     VL S+  KH L
Sbjct: 196 KRSKEQRQRDKLWKRGGLLVFWILSAVVLISVGEKHLL 233


>AE014134-2953|AAN11009.1|  838|Drosophila melanogaster CG31791-PA
           protein.
          Length = 838

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = -3

Query: 196 LDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG--PPKKCDDR 56
           L  +K  +++Y   +D + +   ++  +IA  Q  P P    P +C D+
Sbjct: 378 LQKVKDDIKFYKEQKDMYLQRIEEVQAIIAQEQGFPLPDQLDPSQCRDK 426


>AE014134-807|AAF50958.1|  846|Drosophila melanogaster CG15624-PA,
           isoform A protein.
          Length = 846

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSI--KHQL 173
           +R +EQ  R  L+KRG LL  W     VL S+  KH L
Sbjct: 160 KRSKEQRQRDKLWKRGGLLVFWILSAVVLISVGEKHLL 197


>AF145644-1|AAD38619.1|  601|Drosophila melanogaster BcDNA.GH07688
           protein.
          Length = 601

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY--DAMEDSHCKGFIDLAE 116
           RG+L K    + GW+ R+ VL      L YY  ++  D  C+G I L +
Sbjct: 43  RGYLSKWTNYIYGWQPRYIVLKD--GTLSYYKSESESDFGCRGAISLTK 89


>AE014296-1410|AAF50454.1|  601|Drosophila melanogaster CG7207-PA
           protein.
          Length = 601

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY--DAMEDSHCKGFIDLAE 116
           RG+L K    + GW+ R+ VL      L YY  ++  D  C+G I L +
Sbjct: 43  RGYLSKWTNYIYGWQPRYIVLKD--GTLSYYKSESESDFGCRGAISLTK 89


>BT009929-1|AAQ22398.1| 1936|Drosophila melanogaster SD16537p protein.
          Length = 1936

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +3

Query: 18   LYVRRLVRKSKNDLSSHFLGGPGAGVACVTAITSA 122
            L+  R  R+ +ND  SH  GG GA +A     +SA
Sbjct: 1474 LHCARSPRQQRNDSGSHSNGGGGASLAPCELYSSA 1508


>AE014298-2825|AAF48942.2| 1936|Drosophila melanogaster CG8002-PA
            protein.
          Length = 1936

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +3

Query: 18   LYVRRLVRKSKNDLSSHFLGGPGAGVACVTAITSA 122
            L+  R  R+ +ND  SH  GG GA +A     +SA
Sbjct: 1474 LHCARSPRQQRNDSGSHSNGGGGASLAPCELYSSA 1508


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,650,343
Number of Sequences: 53049
Number of extensions: 266247
Number of successful extensions: 945
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 906
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 939
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1107890535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).