SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   247   7e-66
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   247   7e-66
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   247   7e-66
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   247   7e-66
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   247   7e-66
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   247   7e-66
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   247   7e-66
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   247   7e-66
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   247   7e-66
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   245   2e-65
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   245   2e-65
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   245   2e-65
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   245   2e-65
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   245   2e-65
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   245   2e-65
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   245   2e-65
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   245   2e-65
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   240   7e-64
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   240   7e-64
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   240   7e-64
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    240   7e-64
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   239   1e-63
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   239   1e-63
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   239   1e-63
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   239   1e-63
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   213   9e-56
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   177   7e-45
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   105   5e-40
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   153   1e-37
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   153   1e-37
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   153   1e-37
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   132   3e-31
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   132   3e-31
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   132   3e-31
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    98   5e-21
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    98   7e-21
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    98   7e-21
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    79   3e-15
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    78   6e-15
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    78   6e-15
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    58   7e-09
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    58   7e-09
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    48   9e-06
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    48   9e-06
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    42   4e-04
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    42   4e-04
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    42   4e-04
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.38 
BT001437-1|AAN71192.1|  195|Drosophila melanogaster GH24648p pro...    29   2.7  
AE014296-776|AAN11589.1|  575|Drosophila melanogaster CG32260-PA...    29   2.7  
AF244353-1|AAF82476.1|  117|Drosophila melanogaster 4E-binding p...    29   4.7  
AF132557-1|AAD27856.1|  117|Drosophila melanogaster HL08053p pro...    29   4.7  
AE014134-614|AAF51100.1|  117|Drosophila melanogaster CG8846-PA ...    29   4.7  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   6.2  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   6.2  
BT015252-1|AAT94481.1|  935|Drosophila melanogaster LP17217p pro...    28   8.2  
AY061577-1|AAL29125.1|  558|Drosophila melanogaster SD02805p pro...    28   8.2  
AE013599-591|AAF59133.4| 1155|Drosophila melanogaster CG30372-PB...    28   8.2  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  247 bits (604), Expect = 7e-66
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  245 bits (600), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  240 bits (588), Expect = 7e-64
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  240 bits (588), Expect = 7e-64
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  240 bits (588), Expect = 7e-64
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  240 bits (588), Expect = 7e-64
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  239 bits (586), Expect = 1e-63
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGD  +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  239 bits (586), Expect = 1e-63
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGD  +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  239 bits (586), Expect = 1e-63
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGD  +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  239 bits (586), Expect = 1e-63
 Identities = 106/115 (92%), Positives = 111/115 (96%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGD  +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  213 bits (521), Expect = 9e-56
 Identities = 95/99 (95%), Positives = 97/99 (97%)
 Frame = +2

Query: 131 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGI 310
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTLKYPIEHGI
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 311 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  ITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 99


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  177 bits (431), Expect = 7e-45
 Identities = 81/84 (96%), Positives = 82/84 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDME 334
           SKRGILTLKYPIEHGIVTNWDDME
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDME 84


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  105 bits (251), Expect(2) = 5e-40
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 226
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48



 Score = 77.8 bits (183), Expect(2) = 5e-40
 Identities = 33/33 (100%), Positives = 33/33 (100%)
 Frame = +2

Query: 329 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 80


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  153 bits (372), Expect = 1e-37
 Identities = 70/108 (64%), Positives = 83/108 (76%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEKRGIL 71

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK
Sbjct: 72  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPK 118


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  153 bits (371), Expect = 1e-37
 Identities = 70/108 (64%), Positives = 83/108 (76%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KRGIL
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 63

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK
Sbjct: 64  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPK 110


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  153 bits (371), Expect = 1e-37
 Identities = 70/108 (64%), Positives = 83/108 (76%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 71

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           TLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK
Sbjct: 72  TLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPK 118


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  132 bits (319), Expect = 3e-31
 Identities = 57/107 (53%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPK 424
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPR 118


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  132 bits (319), Expect = 3e-31
 Identities = 57/107 (53%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPK 424
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPR 118


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  132 bits (319), Expect = 3e-31
 Identities = 57/107 (53%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPK 424
           +YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPR 118


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 47/108 (43%), Positives = 68/108 (62%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGD     R +L
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 69

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP
Sbjct: 70  EVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNP 117


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 97.9 bits (233), Expect = 7e-21
 Identities = 47/108 (43%), Positives = 68/108 (62%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGD     R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNP 116


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 97.9 bits (233), Expect = 7e-21
 Identities = 47/108 (43%), Positives = 68/108 (62%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGD     R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
            + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNP 116


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 79.4 bits (187), Expect = 3e-15
 Identities = 42/113 (37%), Positives = 61/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GD  
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             + G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  FDRTGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLN 118


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 78.2 bits (184), Expect = 6e-15
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GD  
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLN 118


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 78.2 bits (184), Expect = 6e-15
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GD  
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLN 118


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 14/123 (11%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-------------RPRHQGVMVGMGQ 232
           +E+ ALV D G    + G+A +D+P+A  PS+VG             +  +        Q
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQ 70

Query: 233 KDSYVGDGHKS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
           +  YV   + +  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA
Sbjct: 71  RKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEA 130

Query: 410 PLN 418
             N
Sbjct: 131 SWN 133


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 14/123 (11%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-------------RPRHQGVMVGMGQ 232
           +E+ ALV D G    + G+A +D+P+A  PS+VG             +  +        Q
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTDNNATPNNADQ 70

Query: 233 KDSYVGDGHKS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
           +  YV   + +  R  + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EA
Sbjct: 71  RKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEA 130

Query: 410 PLN 418
             N
Sbjct: 131 SWN 133


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 15/120 (12%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 250
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 251 DGHKSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 421
           +   +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 15/120 (12%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 250
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 251 DGHKSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 421
           +   +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 3/114 (2%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG+     R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 281 TLKY--PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQ 433
            L Y    + G + NW   + +W + F  + +  + E   +++TE  +N +++Q
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQ 109


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 3/114 (2%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG+     R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 281 TLKY--PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQ 433
            L Y    + G + NW   + +W + F  + +  + E   +++TE  +N +++Q
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQ 109


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 3/114 (2%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG+     R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 281 TLKY--PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQ 433
            L Y    + G + NW   + +W + F  + +  + E   +++TE  +N +++Q
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQ 109


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGS 127
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>BT001437-1|AAN71192.1|  195|Drosophila melanogaster GH24648p
           protein.
          Length = 195

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/56 (30%), Positives = 25/56 (44%)
 Frame = -2

Query: 255 PSPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 88
           P P    F PI  + P    LP+          +P  P   +  PL TT+++T+SS
Sbjct: 51  PPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTPPLITTSSSTTSS 106


>AE014296-776|AAN11589.1|  575|Drosophila melanogaster CG32260-PA
           protein.
          Length = 575

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/56 (30%), Positives = 25/56 (44%)
 Frame = -2

Query: 255 PSPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 88
           P P    F PI  + P    LP+          +P  P   +  PL TT+++T+SS
Sbjct: 51  PPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTPPLITTSSSTTSS 106


>AF244353-1|AAF82476.1|  117|Drosophila melanogaster 4E-binding
           protein THOR protein.
          Length = 117

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +3

Query: 372 SPPRNTPSCLLRLPSTPR-PYR 434
           +PP N PSCLLR   TPR P+R
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFR 89


>AF132557-1|AAD27856.1|  117|Drosophila melanogaster HL08053p
           protein.
          Length = 117

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +3

Query: 372 SPPRNTPSCLLRLPSTPR-PYR 434
           +PP N PSCLLR   TPR P+R
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFR 89


>AE014134-614|AAF51100.1|  117|Drosophila melanogaster CG8846-PA
           protein.
          Length = 117

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +3

Query: 372 SPPRNTPSCLLRLPSTPR-PYR 434
           +PP N PSCLLR   TPR P+R
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFR 89


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 83  MCDEEVAALVVD 118
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 83  MCDEEVAALVVD 118
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>BT015252-1|AAT94481.1|  935|Drosophila melanogaster LP17217p
           protein.
          Length = 935

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = -1

Query: 313 DDSVFDGVFEGQDTSFALVPISYIRVL 233
           D++  +G+ EGQ T   + P+S++ +L
Sbjct: 907 DENWMEGIIEGQPTRKGMFPVSFVHML 933


>AY061577-1|AAL29125.1|  558|Drosophila melanogaster SD02805p
           protein.
          Length = 558

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = -1

Query: 313 DDSVFDGVFEGQDTSFALVPISYIRVL 233
           D++  +G+ EGQ T   + P+S++ +L
Sbjct: 530 DENWMEGIIEGQPTRKGMFPVSFVHML 556


>AE013599-591|AAF59133.4| 1155|Drosophila melanogaster CG30372-PB
            protein.
          Length = 1155

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = -1

Query: 313  DDSVFDGVFEGQDTSFALVPISYIRVL 233
            D++  +G+ EGQ T   + P+S++ +L
Sbjct: 1127 DENWMEGIIEGQPTRKGMFPVSFVHML 1153


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,203,267
Number of Sequences: 53049
Number of extensions: 657692
Number of successful extensions: 2115
Number of sequences better than 10.0: 58
Number of HSP's better than 10.0 without gapping: 1917
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2095
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1784022528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).