SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY119495-1|AAM50149.1|  432|Drosophila melanogaster GH10162p pro...    38   0.011
AE013599-3106|AAF46655.1|  432|Drosophila melanogaster CG3295-PA...    38   0.011
AF160938-1|AAD46878.1|  845|Drosophila melanogaster BcDNA.LD1876...    35   0.079
AE014134-1943|AAF53002.1|  845|Drosophila melanogaster CG6743-PA...    35   0.079
EF057988-1|ABL84923.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057987-1|ABL84922.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057986-1|ABL84921.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057985-1|ABL84920.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057984-1|ABL84919.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057983-1|ABL84918.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057982-1|ABL84917.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057981-1|ABL84916.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057979-1|ABL84914.1|  846|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057978-1|ABL84913.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057977-1|ABL84912.1|  845|Drosophila melanogaster Nup107 protein.    33   0.18 
EF057980-1|ABL84915.1|  845|Drosophila melanogaster Nup107 protein.    31   0.74 
BT023819-1|AAZ86740.1|  741|Drosophila melanogaster SD06601p pro...    29   5.2  
AJ606680-1|CAE54809.1|  741|Drosophila melanogaster lamin B rece...    29   5.2  
AY060601-1|AAL28149.1|  470|Drosophila melanogaster GH01839p pro...    28   6.9  
AE013599-570|AAF59148.2|  470|Drosophila melanogaster CG14762-PA...    28   6.9  

>AY119495-1|AAM50149.1|  432|Drosophila melanogaster GH10162p
           protein.
          Length = 432

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +1

Query: 301 PNTP--LTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLL 474
           P  P  LT  Q + V    +   +   +LST+HR+LH ++SK G+     F       + 
Sbjct: 81  PTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM- 139

Query: 475 QRREMFCSDENHLLWNKPL 531
            R ++   +EN +L NK +
Sbjct: 140 -RVDVLQDEENLMLLNKAI 157


>AE013599-3106|AAF46655.1|  432|Drosophila melanogaster CG3295-PA
           protein.
          Length = 432

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +1

Query: 301 PNTP--LTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLL 474
           P  P  LT  Q + V    +   +   +LST+HR+LH ++SK G+     F       + 
Sbjct: 81  PTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM- 139

Query: 475 QRREMFCSDENHLLWNKPL 531
            R ++   +EN +L NK +
Sbjct: 140 -RVDVLQDEENLMLLNKAI 157


>AF160938-1|AAD46878.1|  845|Drosophila melanogaster BcDNA.LD18761
           protein.
          Length = 845

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QLS DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLSWDHRLL 764


>AE014134-1943|AAF53002.1|  845|Drosophila melanogaster CG6743-PA
           protein.
          Length = 845

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QLS DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLSWDHRLL 764


>EF057988-1|ABL84923.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057987-1|ABL84922.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057986-1|ABL84921.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057985-1|ABL84920.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057984-1|ABL84919.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057983-1|ABL84918.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057982-1|ABL84917.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057981-1|ABL84916.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057979-1|ABL84914.1|  846|Drosophila melanogaster Nup107 protein.
          Length = 846

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 709 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 765


>EF057978-1|ABL84913.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057977-1|ABL84912.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>EF057980-1|ABL84915.1|  845|Drosophila melanogaster Nup107 protein.
          Length = 845

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV E   +  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 708 HRSEVVRWEHKVXEQXXQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764


>BT023819-1|AAZ86740.1|  741|Drosophila melanogaster SD06601p
           protein.
          Length = 741

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -2

Query: 312 WCIWWLLGYFPPQLLYFVNISCNTSSVCSFKFVNFVIAL 196
           W   +LL    P  +Y++  SC   + C FK +N  I L
Sbjct: 311 WLGAFLLLLLLPTAVYYLTWSCTARNACQFKHLNLGILL 349


>AJ606680-1|CAE54809.1|  741|Drosophila melanogaster lamin B
           receptor protein.
          Length = 741

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -2

Query: 312 WCIWWLLGYFPPQLLYFVNISCNTSSVCSFKFVNFVIAL 196
           W   +LL    P  +Y++  SC   + C FK +N  I L
Sbjct: 311 WLGAFLLLLLLPTAVYYLTWSCTARNACQFKHLNLGILL 349


>AY060601-1|AAL28149.1|  470|Drosophila melanogaster GH01839p
           protein.
          Length = 470

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +1

Query: 286 IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKS 423
           + Q PP T + PEQ++ ++    T+K+N   +  +  +L A ++KS
Sbjct: 29  LGQGPPQTQVCPEQSE-IAPCICTVKKNGLDILCETTDL-AHITKS 72


>AE013599-570|AAF59148.2|  470|Drosophila melanogaster CG14762-PA
           protein.
          Length = 470

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +1

Query: 286 IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKS 423
           + Q PP T + PEQ++ ++    T+K+N   +  +  +L A ++KS
Sbjct: 29  LGQGPPQTQVCPEQSE-IAPCICTVKKNGLDILCETTDL-AHITKS 72


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,377,691
Number of Sequences: 53049
Number of extensions: 502516
Number of successful extensions: 1163
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1161
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1991467008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).