SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089523-1|AAL90261.1|  143|Drosophila melanogaster GM14585p pro...   107   8e-24
AE013599-1845|AAF58277.2|  143|Drosophila melanogaster CG8415-PA...   107   8e-24
M19494-1|AAA28935.1|  140|Drosophila melanogaster protein ( D.me...    34   0.12 
BT015958-1|AAV36843.1|  140|Drosophila melanogaster RH56553p pro...    34   0.12 
AL133505-2|CAB65841.1|  140|Drosophila melanogaster EG:BACH59J11...    34   0.12 
AL133505-1|CAB63528.1|  154|Drosophila melanogaster EG:BACH59J11...    34   0.12 
AE014298-399|AAF45781.1|  140|Drosophila melanogaster CG7925-PB ...    34   0.12 
AJ250320-1|CAB65721.1|  140|Drosophila melanogaster technical kn...    31   0.84 
BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p pro...    29   5.9  
AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p pro...    29   5.9  
AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC...    29   5.9  
AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB...    29   5.9  
AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA...    29   5.9  
AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypept...    29   5.9  
L11451-1|AAA28918.1|  786|Drosophila melanogaster serine protein...    28   7.8  
AY119618-1|AAM50272.1|  683|Drosophila melanogaster LD44584p pro...    28   7.8  
AE014297-2154|AAF55277.1|  787|Drosophila melanogaster CG4316-PA...    28   7.8  

>AY089523-1|AAL90261.1|  143|Drosophila melanogaster GM14585p
           protein.
          Length = 143

 Score =  107 bits (258), Expect = 8e-24
 Identities = 51/52 (98%), Positives = 52/52 (100%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N+IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS
Sbjct: 92  NYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 38/41 (92%), Positives = 39/41 (95%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVPRDG
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDG 89


>AE013599-1845|AAF58277.2|  143|Drosophila melanogaster CG8415-PA
           protein.
          Length = 143

 Score =  107 bits (258), Expect = 8e-24
 Identities = 51/52 (98%), Positives = 52/52 (100%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N+IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS
Sbjct: 92  NYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 38/41 (92%), Positives = 39/41 (95%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVPRDG
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDG 89


>M19494-1|AAA28935.1|  140|Drosophila melanogaster protein (
           D.melanogaster tko (technical knockout) locus mRNA
           encoding tko gene product,complete cds. ).
          Length = 140

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>BT015958-1|AAV36843.1|  140|Drosophila melanogaster RH56553p
           protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AL133505-2|CAB65841.1|  140|Drosophila melanogaster
           EG:BACH59J11.1,FBgn0003714;tko protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AL133505-1|CAB63528.1|  154|Drosophila melanogaster
           EG:BACH59J11.1,FBgn0003714;tko protein.
          Length = 154

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 74  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 113


>AE014298-399|AAF45781.1|  140|Drosophila melanogaster CG7925-PB
           protein.
          Length = 140

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>AJ250320-1|CAB65721.1|  140|Drosophila melanogaster technical
           knockout protein protein.
          Length = 140

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+    GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVR-HSTGKEMVAYIPGIG 99


>BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p
           protein.
          Length = 507

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 332 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 369


>AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC,
           isoform C protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB,
           isoform B protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA,
           isoform A protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypeptide
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 83  HNVHL*SWSLLFLFVESEERHVGYFYHLKTNSGNV-TDGV 199
           HN++   W  +  + E   R VG F+H KTN+ N+ TDG+
Sbjct: 393 HNINSQVWCQI-AYWEMAHR-VGEFFHAKTNAVNIYTDGI 430


>L11451-1|AAA28918.1|  786|Drosophila melanogaster serine proteinase
           protein.
          Length = 786

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/37 (48%), Positives = 21/37 (56%)
 Frame = +3

Query: 135 RRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSS 245
           RR T  T TT +RT    PT    RP  ATS+SS S+
Sbjct: 423 RRTTTPT-TTTRRTTTNKPTRPYQRPTTATSSSSTST 458


>AY119618-1|AAM50272.1|  683|Drosophila melanogaster LD44584p
           protein.
          Length = 683

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/37 (48%), Positives = 21/37 (56%)
 Frame = +3

Query: 135 RRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSS 245
           RR T  T TT +RT    PT    RP  ATS+SS S+
Sbjct: 320 RRTTTPT-TTTRRTTTNKPTRPYQRPTTATSSSSTST 355


>AE014297-2154|AAF55277.1|  787|Drosophila melanogaster CG4316-PA
           protein.
          Length = 787

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/37 (48%), Positives = 21/37 (56%)
 Frame = +3

Query: 135 RRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSS 245
           RR T  T TT +RT    PT    RP  ATS+SS S+
Sbjct: 424 RRTTTPT-TTTRRTTTNKPTRPYQRPTTATSSSSTST 459


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,862,526
Number of Sequences: 53049
Number of extensions: 619061
Number of successful extensions: 1932
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1660
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1932
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2255362491
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).