SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061059-1|AAL28607.1|  611|Drosophila melanogaster LD02975p pro...   131   8e-31
AE014298-2195|AAN09361.1|  611|Drosophila melanogaster CG9281-PC...   131   8e-31
AE014298-2194|AAF48493.1|  611|Drosophila melanogaster CG9281-PB...   131   8e-31
AY095079-1|AAM11407.1|  638|Drosophila melanogaster RE26764p pro...    70   3e-12
AE014296-3174|AAF49142.1|  708|Drosophila melanogaster CG9330-PA...    70   3e-12
BT021418-1|AAX33566.1|  901|Drosophila melanogaster LD04461p pro...    57   2e-08
AE014298-1652|AAF48069.1|  901|Drosophila melanogaster CG1703-PA...    57   2e-08
AE014297-3567|AAF56312.2| 1402|Drosophila melanogaster CG5789-PA...    36   0.031
AY121669-1|AAM51996.1| 1302|Drosophila melanogaster RE14657p pro...    33   0.22 
AY118902-1|AAM50762.1|  665|Drosophila melanogaster LD11581p pro...    33   0.29 
AE014298-2935|AAF49018.2|  665|Drosophila melanogaster CG12703-P...    33   0.29 
AY069841-1|AAL39986.1|  780|Drosophila melanogaster SD08664p pro...    32   0.50 
AF167431-1|AAF06736.1| 2173|Drosophila melanogaster sulfonyl ure...    32   0.50 
AE014134-1771|AAF52866.3| 2177|Drosophila melanogaster CG5772-PA...    32   0.50 
M59077-1|AAA28680.1| 1302|Drosophila melanogaster P-glycoprotein...    32   0.66 
AF251287-1|AAF69147.1| 1302|Drosophila melanogaster P-glycoprote...    32   0.66 
AF251286-1|AAF69146.1| 1302|Drosophila melanogaster P-glycoprote...    32   0.66 
AE014296-1105|AAF50669.1| 1302|Drosophila melanogaster CG10181-P...    32   0.66 
BT003531-1|AAO39535.1|  777|Drosophila melanogaster RE14039p pro...    31   1.2  
AY069827-1|AAL39972.1| 1548|Drosophila melanogaster SD07655p pro...    31   1.2  
AE014297-4257|AAN14146.1|  777|Drosophila melanogaster CG9990-PB...    31   1.2  
AE014297-4256|AAF56807.1|  808|Drosophila melanogaster CG9990-PA...    31   1.2  
AE014297-3940|ABC66191.1|  777|Drosophila melanogaster CG33970-P...    31   1.2  
AE014134-2257|AAS64699.1| 1548|Drosophila melanogaster CG6214-PM...    31   1.2  
AE014134-2256|AAS64698.1| 1548|Drosophila melanogaster CG6214-PQ...    31   1.2  
AE014134-2255|AAS64697.1| 1548|Drosophila melanogaster CG6214-PL...    31   1.2  
AE014134-2254|AAS64696.1| 1549|Drosophila melanogaster CG6214-PI...    31   1.2  
AE014134-2253|AAG22430.2| 1548|Drosophila melanogaster CG6214-PB...    31   1.2  
AE014134-2252|AAS64695.1| 1548|Drosophila melanogaster CG6214-PK...    31   1.2  
AE014134-2251|AAS64694.1| 1548|Drosophila melanogaster CG6214-PN...    31   1.2  
AE014134-2250|AAS64693.1| 1548|Drosophila melanogaster CG6214-PJ...    31   1.2  
AE014134-2249|AAS64692.1| 1548|Drosophila melanogaster CG6214-PH...    31   1.2  
AE014134-2248|AAS64691.1| 1548|Drosophila melanogaster CG6214-PP...    31   1.2  
AE014134-2247|AAS64690.1| 1548|Drosophila melanogaster CG6214-PG...    31   1.2  
AE014134-2246|AAS64689.1| 1549|Drosophila melanogaster CG6214-PO...    31   1.2  
AE014134-2245|AAF53223.4| 1549|Drosophila melanogaster CG6214-PA...    31   1.2  
AE014134-2244|AAS64688.1| 1548|Drosophila melanogaster CG6214-PC...    31   1.2  
AE014134-2243|AAS64687.1| 1548|Drosophila melanogaster CG6214-PF...    31   1.2  
AE014134-2242|AAS64686.1| 1548|Drosophila melanogaster CG6214-PE...    31   1.2  
AE014134-2241|AAS64685.1| 1548|Drosophila melanogaster CG6214-PD...    31   1.2  
BT010210-1|AAQ23528.1|  711|Drosophila melanogaster RH61964p pro...    31   1.5  
AE014134-965|AAN10554.1|  711|Drosophila melanogaster CG11147-PB...    31   1.5  
AE014134-964|AAF52284.2|  711|Drosophila melanogaster CG11147-PA...    31   1.5  
M59076-1|AAA28679.1| 1302|Drosophila melanogaster P glycoprotein...    30   2.0  
AY058791-1|AAL14020.1| 1302|Drosophila melanogaster SD10012p pro...    30   2.0  
AE013599-1620|AAF58437.2| 1302|Drosophila melanogaster CG3879-PA...    30   2.0  
AY051660-1|AAK93084.1| 1374|Drosophila melanogaster LD17001p pro...    30   2.7  
AE014297-4346|AAN14163.1| 1374|Drosophila melanogaster CG11897-P...    30   2.7  
AE014297-4345|AAF56869.2| 1374|Drosophila melanogaster CG11897-P...    30   2.7  
AE014296-1104|AAF50670.1| 1320|Drosophila melanogaster CG10226-P...    30   2.7  
L07065-1|AAA16186.1| 1283|Drosophila melanogaster P-glycoprotein...    29   3.5  
BT021362-1|AAX33510.1| 1313|Drosophila melanogaster LP14331p pro...    29   3.5  
AE013599-1857|AAF58271.3| 1313|Drosophila melanogaster CG8523-PA...    29   3.5  
AY051962-1|AAK93386.1| 1487|Drosophila melanogaster LD42916p pro...    29   4.7  
AE014134-1458|AAF52639.1| 1487|Drosophila melanogaster CG7806-PA...    29   4.7  
M20630-1|AAA28397.1|  675|Drosophila melanogaster protein ( D.me...    29   6.2  
L23543-1|AAC37214.1|  675|Drosophila melanogaster brown protein ...    29   6.2  
L05635-1|AAA28398.1|  675|Drosophila melanogaster brown protein ...    29   6.2  
AY119503-1|AAM50157.1|  328|Drosophila melanogaster GH12107p pro...    29   6.2  
AY094726-1|AAM11079.1|  428|Drosophila melanogaster GH23040p pro...    29   6.2  
AE014297-68|AAF52139.2|  473|Drosophila melanogaster CG1090-PA, ...    29   6.2  
AE014297-67|AAN13306.3|  642|Drosophila melanogaster CG1090-PB, ...    29   6.2  
AE013599-3619|AAF47020.3|  675|Drosophila melanogaster CG17632-P...    29   6.2  
AY118801-1|AAM50661.1|  761|Drosophila melanogaster GH19726p pro...    28   8.2  
AY060964-1|AAL28512.1|  709|Drosophila melanogaster GM09415p pro...    28   8.2  
AE014298-1785|AAF48177.1|  761|Drosophila melanogaster CG1824-PA...    28   8.2  
AE013599-2492|AAM70883.1|  709|Drosophila melanogaster CG4853-PB...    28   8.2  
AE013599-2491|AAF57849.2|  709|Drosophila melanogaster CG4853-PA...    28   8.2  

>AY061059-1|AAL28607.1|  611|Drosophila melanogaster LD02975p
           protein.
          Length = 611

 Score =  131 bits (316), Expect = 8e-31
 Identities = 59/69 (85%), Positives = 64/69 (92%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRD+KIANFSITF+GSELLQDT+LELNCGRRYGL+GLNGCGKSSLLA L  REVP+P 
Sbjct: 69  PRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPP 128

Query: 431 HIDIFHLTR 457
           HIDIFHLTR
Sbjct: 129 HIDIFHLTR 137



 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +3

Query: 204 KMNSEARSCTGSLAVHP 254
           ++++EARSCTGSLAVHP
Sbjct: 53  RISAEARSCTGSLAVHP 69


>AE014298-2195|AAN09361.1|  611|Drosophila melanogaster CG9281-PC,
           isoform C protein.
          Length = 611

 Score =  131 bits (316), Expect = 8e-31
 Identities = 59/69 (85%), Positives = 64/69 (92%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRD+KIANFSITF+GSELLQDT+LELNCGRRYGL+GLNGCGKSSLLA L  REVP+P 
Sbjct: 69  PRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPP 128

Query: 431 HIDIFHLTR 457
           HIDIFHLTR
Sbjct: 129 HIDIFHLTR 137



 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +3

Query: 204 KMNSEARSCTGSLAVHP 254
           ++++EARSCTGSLAVHP
Sbjct: 53  RISAEARSCTGSLAVHP 69


>AE014298-2194|AAF48493.1|  611|Drosophila melanogaster CG9281-PB,
           isoform B protein.
          Length = 611

 Score =  131 bits (316), Expect = 8e-31
 Identities = 59/69 (85%), Positives = 64/69 (92%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRD+KIANFSITF+GSELLQDT+LELNCGRRYGL+GLNGCGKSSLLA L  REVP+P 
Sbjct: 69  PRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPP 128

Query: 431 HIDIFHLTR 457
           HIDIFHLTR
Sbjct: 129 HIDIFHLTR 137



 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +3

Query: 204 KMNSEARSCTGSLAVHP 254
           ++++EARSCTGSLAVHP
Sbjct: 53  RISAEARSCTGSLAVHP 69


>AY095079-1|AAM11407.1|  638|Drosophila melanogaster RE26764p
           protein.
          Length = 638

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 33/65 (50%), Positives = 43/65 (66%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S DIKI NF + F    LLQ+  L L+ GRRYGLVG NG GK++LL  +  R++ IP HI
Sbjct: 105 SMDIKIENFDLAFGEKVLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHI 164

Query: 437 DIFHL 451
            + H+
Sbjct: 165 SVLHV 169


>AE014296-3174|AAF49142.1|  708|Drosophila melanogaster CG9330-PA
           protein.
          Length = 708

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 33/65 (50%), Positives = 43/65 (66%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S DIKI NF + F    LLQ+  L L+ GRRYGLVG NG GK++LL  +  R++ IP HI
Sbjct: 175 SMDIKIENFDLAFGEKVLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SVLHV 239


>BT021418-1|AAX33566.1|  901|Drosophila melanogaster LD04461p
           protein.
          Length = 901

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIKI NF+I+  G++L  +  L +  GRRYGLVG NG GK++LL  +  R   IP +ID+
Sbjct: 351 DIKIENFTISAKGNDLFVNANLLIAHGRRYGLVGPNGHGKTTLLRHIATRAFAIPPNIDV 410


>AE014298-1652|AAF48069.1|  901|Drosophila melanogaster CG1703-PA
           protein.
          Length = 901

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIKI NF+I+  G++L  +  L +  GRRYGLVG NG GK++LL  +  R   IP +ID+
Sbjct: 351 DIKIENFTISAKGNDLFVNANLLIAHGRRYGLVGPNGHGKTTLLRHIATRAFAIPPNIDV 410


>AE014297-3567|AAF56312.2| 1402|Drosophila melanogaster CG5789-PA
            protein.
          Length = 1402

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITF--YGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    ++  N S  +   GS +L++  L +  G + G+VG  G GKSSL+ AL R
Sbjct: 1132 PTRGQVEFRNMSCRYDPNGSPVLRNLNLTIEAGWKVGIVGRTGAGKSSLIGALFR 1186


>AY121669-1|AAM51996.1| 1302|Drosophila melanogaster RE14657p protein.
          Length = 1302

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 7/86 (8%)
 Frame = +2

Query: 302  SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP-----EHIDIFH-LTRGG 463
            +++L    LE+  G+   LVG +GCGKS+ +  L+R   P       +H DI H LT  G
Sbjct: 1074 AKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDG 1133

Query: 464  ARYPIRPIVSRITIHGRRFT-NVVTG 538
             R  +  +    T+  R    N+V G
Sbjct: 1134 VRTKLGIVSQEPTLFERSIAENIVYG 1159



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + +  G+   LVG +GCGKS+ +  L+R   P+
Sbjct: 428 IRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPV 460


>AY118902-1|AAM50762.1|  665|Drosophila melanogaster LD11581p
           protein.
          Length = 665

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +T  G  LLQ+   E+  G    + G NGCGKSSL   L
Sbjct: 454 VTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRIL 492


>AE014298-2935|AAF49018.2|  665|Drosophila melanogaster CG12703-PA
           protein.
          Length = 665

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +T  G  LLQ+   E+  G    + G NGCGKSSL   L
Sbjct: 454 VTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRIL 492


>AY069841-1|AAL39986.1|  780|Drosophila melanogaster SD08664p
           protein.
          Length = 780

 Score = 32.3 bits (70), Expect = 0.50
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSL 391
           P   DI   N S+ + G +  ++ +  L++  G+R G+ G  G GKSSL
Sbjct: 534 PQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSL 582


>AF167431-1|AAF06736.1| 2173|Drosophila melanogaster sulfonyl urea
            receptor protein.
          Length = 2173

 Score = 32.3 bits (70), Expect = 0.50
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSL 391
            P   DI   N S+ + G +  ++ +  L++  G+R G+ G  G GKSSL
Sbjct: 1927 PQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSL 1975


>AE014134-1771|AAF52866.3| 2177|Drosophila melanogaster CG5772-PA
            protein.
          Length = 2177

 Score = 32.3 bits (70), Expect = 0.50
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSL 391
            P   DI   N S+ + G +  ++ +  L++  G+R G+ G  G GKSSL
Sbjct: 1931 PQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSL 1979


>M59077-1|AAA28680.1| 1302|Drosophila melanogaster P-glycoprotein
            protein.
          Length = 1302

 Score = 31.9 bits (69), Expect = 0.66
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 7/86 (8%)
 Frame = +2

Query: 302  SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP-----EHIDIFH-LTRGG 463
            +++L    LE+  G+   LVG +GCGKS+ +  L+R   P       +H DI H LT  G
Sbjct: 1074 AKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDG 1133

Query: 464  ARYPIRPIVSRITIHGRRFT-NVVTG 538
             R  +  +    T+  R    N+  G
Sbjct: 1134 VRTKLGIVSQEPTLFERSIAENIAYG 1159



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + +  G+   LVG +GCGKS+ +  L+R   P+
Sbjct: 428 IRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPV 460


>AF251287-1|AAF69147.1| 1302|Drosophila melanogaster P-glycoprotein
            protein.
          Length = 1302

 Score = 31.9 bits (69), Expect = 0.66
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 7/86 (8%)
 Frame = +2

Query: 302  SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP-----EHIDIFH-LTRGG 463
            +++L    LE+  G+   LVG +GCGKS+ +  L+R   P       +H DI H LT  G
Sbjct: 1074 AKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDG 1133

Query: 464  ARYPIRPIVSRITIHGRRFT-NVVTG 538
             R  +  +    T+  R    N+  G
Sbjct: 1134 VRTKLGIVSQEPTLFERSIAENIAYG 1159



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + +  G+   LVG +GCGKS+ +  L+R   P+
Sbjct: 428 IRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPV 460


>AF251286-1|AAF69146.1| 1302|Drosophila melanogaster P-glycoprotein
            protein.
          Length = 1302

 Score = 31.9 bits (69), Expect = 0.66
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 7/86 (8%)
 Frame = +2

Query: 302  SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP-----EHIDIFH-LTRGG 463
            +++L    LE+  G+   LVG +GCGKS+ +  L+R   P       +H DI H LT  G
Sbjct: 1074 AKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDG 1133

Query: 464  ARYPIRPIVSRITIHGRRFT-NVVTG 538
             R  +  +    T+  R    N+  G
Sbjct: 1134 VRTKLGIVSQEPTLFERSIAENIAYG 1159



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + +  G+   LVG +GCGKS+ +  L+R   P+
Sbjct: 428 IRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPV 460


>AE014296-1105|AAF50669.1| 1302|Drosophila melanogaster CG10181-PA
            protein.
          Length = 1302

 Score = 31.9 bits (69), Expect = 0.66
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 7/86 (8%)
 Frame = +2

Query: 302  SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP-----EHIDIFH-LTRGG 463
            +++L    LE+  G+   LVG +GCGKS+ +  L+R   P       +H DI H LT  G
Sbjct: 1074 AKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDG 1133

Query: 464  ARYPIRPIVSRITIHGRRFT-NVVTG 538
             R  +  +    T+  R    N+  G
Sbjct: 1134 VRTKLGIVSQEPTLFERSIAENIAYG 1159



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + +  G+   LVG +GCGKS+ +  L+R   P+
Sbjct: 428 IRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPV 460


>BT003531-1|AAO39535.1|  777|Drosophila melanogaster RE14039p
           protein.
          Length = 777

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 2/26 (7%)
 Frame = +2

Query: 341 GRRYGLVGLNGCGKSSLLAAL--RRR 412
           G  YGL+G +GCGK++LL+ +  RRR
Sbjct: 77  GSIYGLLGASGCGKTTLLSCIVGRRR 102


>AY069827-1|AAL39972.1| 1548|Drosophila melanogaster SD07655p protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014297-4257|AAN14146.1|  777|Drosophila melanogaster CG9990-PB,
           isoform B protein.
          Length = 777

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 12/34 (35%), Positives = 24/34 (70%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++L +  + +  G  YGL+G +GCGK++LL+ +
Sbjct: 59  NQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCI 92


>AE014297-4256|AAF56807.1|  808|Drosophila melanogaster CG9990-PA,
           isoform A protein.
          Length = 808

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 12/34 (35%), Positives = 24/34 (70%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++L +  + +  G  YGL+G +GCGK++LL+ +
Sbjct: 90  NQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCI 123


>AE014297-3940|ABC66191.1|  777|Drosophila melanogaster CG33970-PA,
           isoform A protein.
          Length = 777

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 2/26 (7%)
 Frame = +2

Query: 341 GRRYGLVGLNGCGKSSLLAAL--RRR 412
           G  YGL+G +GCGK++LL+ +  RRR
Sbjct: 77  GSIYGLLGASGCGKTTLLSCIVGRRR 102


>AE014134-2257|AAS64699.1| 1548|Drosophila melanogaster CG6214-PM,
            isoform M protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2256|AAS64698.1| 1548|Drosophila melanogaster CG6214-PQ,
            isoform Q protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2255|AAS64697.1| 1548|Drosophila melanogaster CG6214-PL,
            isoform L protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2254|AAS64696.1| 1549|Drosophila melanogaster CG6214-PI,
            isoform I protein.
          Length = 1549

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1310 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1359


>AE014134-2253|AAG22430.2| 1548|Drosophila melanogaster CG6214-PB,
            isoform B protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2252|AAS64695.1| 1548|Drosophila melanogaster CG6214-PK,
            isoform K protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2251|AAS64694.1| 1548|Drosophila melanogaster CG6214-PN,
            isoform N protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2250|AAS64693.1| 1548|Drosophila melanogaster CG6214-PJ,
            isoform J protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2249|AAS64692.1| 1548|Drosophila melanogaster CG6214-PH,
            isoform H protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2248|AAS64691.1| 1548|Drosophila melanogaster CG6214-PP,
            isoform P protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2247|AAS64690.1| 1548|Drosophila melanogaster CG6214-PG,
            isoform G protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2246|AAS64689.1| 1549|Drosophila melanogaster CG6214-PO,
            isoform O protein.
          Length = 1549

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1310 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1359


>AE014134-2245|AAF53223.4| 1549|Drosophila melanogaster CG6214-PA,
            isoform A protein.
          Length = 1549

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1310 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1359


>AE014134-2244|AAS64688.1| 1548|Drosophila melanogaster CG6214-PC,
            isoform C protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2243|AAS64687.1| 1548|Drosophila melanogaster CG6214-PF,
            isoform F protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2242|AAS64686.1| 1548|Drosophila melanogaster CG6214-PE,
            isoform E protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>AE014134-2241|AAS64685.1| 1548|Drosophila melanogaster CG6214-PD,
            isoform D protein.
          Length = 1548

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 266  IKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  NF + +  G +L L+     +  G + G+VG  G GKSSL  AL R
Sbjct: 1309 VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFR 1358


>BT010210-1|AAQ23528.1|  711|Drosophila melanogaster RH61964p
           protein.
          Length = 711

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 5/42 (11%)
 Frame = +2

Query: 293 FYGSELLQDTLL-ELNC----GRRYGLVGLNGCGKSSLLAAL 403
           +YGS+     +L +LN     G  YGL+G +GCGK++LL+ +
Sbjct: 12  YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCI 53


>AE014134-965|AAN10554.1|  711|Drosophila melanogaster CG11147-PB,
           isoform B protein.
          Length = 711

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 5/42 (11%)
 Frame = +2

Query: 293 FYGSELLQDTLL-ELNC----GRRYGLVGLNGCGKSSLLAAL 403
           +YGS+     +L +LN     G  YGL+G +GCGK++LL+ +
Sbjct: 12  YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCI 53


>AE014134-964|AAF52284.2|  711|Drosophila melanogaster CG11147-PA,
           isoform A protein.
          Length = 711

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 5/42 (11%)
 Frame = +2

Query: 293 FYGSELLQDTLL-ELNC----GRRYGLVGLNGCGKSSLLAAL 403
           +YGS+     +L +LN     G  YGL+G +GCGK++LL+ +
Sbjct: 12  YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCI 53


>M59076-1|AAA28679.1| 1302|Drosophila melanogaster P glycoprotein
           protein.
          Length = 1302

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           E+L+   +++  G+    VG +GCGKS+L+  ++R
Sbjct: 418 EILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQR 452


>AY058791-1|AAL14020.1| 1302|Drosophila melanogaster SD10012p
           protein.
          Length = 1302

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           E+L+   +++  G+    VG +GCGKS+L+  ++R
Sbjct: 418 EILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQR 452


>AE013599-1620|AAF58437.2| 1302|Drosophila melanogaster CG3879-PA
           protein.
          Length = 1302

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           E+L+   +++  G+    VG +GCGKS+L+  ++R
Sbjct: 418 EILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQR 452


>AY051660-1|AAK93084.1| 1374|Drosophila melanogaster LD17001p protein.
          Length = 1374

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  NF + +   E  +L+D    +    + G+VG  G GKSS++ ++ R
Sbjct: 1093 PSKGRIEFINFKLRYSPKEAPVLKDLNFTIEPREKIGIVGRTGAGKSSIIQSIFR 1147


>AE014297-4346|AAN14163.1| 1374|Drosophila melanogaster CG11897-PB,
            isoform B protein.
          Length = 1374

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  NF + +   E  +L+D    +    + G+VG  G GKSS++ ++ R
Sbjct: 1093 PSKGRIEFINFKLRYSPKEAPVLKDLNFTIEPREKIGIVGRTGAGKSSIIQSIFR 1147


>AE014297-4345|AAF56869.2| 1374|Drosophila melanogaster CG11897-PA,
            isoform A protein.
          Length = 1374

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  NF + +   E  +L+D    +    + G+VG  G GKSS++ ++ R
Sbjct: 1093 PSKGRIEFINFKLRYSPKEAPVLKDLNFTIEPREKIGIVGRTGAGKSSIIQSIFR 1147


>AE014296-1104|AAF50670.1| 1320|Drosophila melanogaster CG10226-PA
            protein.
          Length = 1320

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++LQ+  L++N G+   LVG +G GKS+ +  L R
Sbjct: 1092 KVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMR 1126


>L07065-1|AAA16186.1| 1283|Drosophila melanogaster
            P-glycoprotein/multidrug resistanceprotein protein.
          Length = 1283

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++L+   L ++ G++  LVG +GCGKS+ +  ++R
Sbjct: 1056 QVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQR 1090



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L    L+++ G+   LVG +GCGKS+ +  ++R
Sbjct: 417 ILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQR 450


>BT021362-1|AAX33510.1| 1313|Drosophila melanogaster LP14331p protein.
          Length = 1313

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++L+   L ++ G++  LVG +GCGKS+ +  ++R
Sbjct: 1086 QVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQR 1120



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L    L+++ G+   LVG +GCGKS+ +  ++R
Sbjct: 448 ILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQR 481


>AE013599-1857|AAF58271.3| 1313|Drosophila melanogaster CG8523-PA
            protein.
          Length = 1313

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++L+   L ++ G++  LVG +GCGKS+ +  ++R
Sbjct: 1086 QVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQR 1120



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L    L+++ G+   LVG +GCGKS+ +  ++R
Sbjct: 448 ILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQR 481


>AY051962-1|AAK93386.1| 1487|Drosophila melanogaster LD42916p protein.
          Length = 1487

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 347  RYGLVGLNGCGKSSLLAALRR 409
            R G+VG  G GK+S+LAAL R
Sbjct: 1269 RIGIVGRTGAGKTSVLAALLR 1289


>AE014134-1458|AAF52639.1| 1487|Drosophila melanogaster CG7806-PA
            protein.
          Length = 1487

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 347  RYGLVGLNGCGKSSLLAALRR 409
            R G+VG  G GK+S+LAAL R
Sbjct: 1269 RIGIVGRTGAGKTSVLAALLR 1289


>M20630-1|AAA28397.1|  675|Drosophila melanogaster protein (
           D.melanogaster brown(bw) mRNA encoding brown protein,
           complete cds. ).
          Length = 675

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +LQD    +  G    ++G +G GK++LLAA+ +R
Sbjct: 48  ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQR 82


>L23543-1|AAC37214.1|  675|Drosophila melanogaster brown protein
           protein.
          Length = 675

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +LQD    +  G    ++G +G GK++LLAA+ +R
Sbjct: 48  ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQR 82


>L05635-1|AAA28398.1|  675|Drosophila melanogaster brown protein
           protein.
          Length = 675

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +LQD    +  G    ++G +G GK++LLAA+ +R
Sbjct: 48  ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQR 82


>AY119503-1|AAM50157.1|  328|Drosophila melanogaster GH12107p
           protein.
          Length = 328

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +LQD    +  G    ++G +G GK++LLAA+ +R
Sbjct: 48  ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQR 82


>AY094726-1|AAM11079.1|  428|Drosophila melanogaster GH23040p
           protein.
          Length = 428

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVP 467
           +P H +CK T  +C    YR NW P
Sbjct: 284 YPIHFLCKKTMPDCRQEQYR-NWYP 307


>AE014297-68|AAF52139.2|  473|Drosophila melanogaster CG1090-PA,
           isoform A protein.
          Length = 473

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVP 467
           +P H +CK T  +C    YR NW P
Sbjct: 284 YPIHFLCKKTMPDCRQEQYR-NWYP 307


>AE014297-67|AAN13306.3|  642|Drosophila melanogaster CG1090-PB,
           isoform B protein.
          Length = 642

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVP 467
           +P H +CK T  +C    YR NW P
Sbjct: 453 YPIHFLCKKTMPDCRQEQYR-NWYP 476


>AE013599-3619|AAF47020.3|  675|Drosophila melanogaster CG17632-PA
           protein.
          Length = 675

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +LQD    +  G    ++G +G GK++LLAA+ +R
Sbjct: 48  ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQR 82


>AY118801-1|AAM50661.1|  761|Drosophila melanogaster GH19726p
           protein.
          Length = 761

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +L+D  L L  G+   LVG +G GKS++ + + R   P   +I +
Sbjct: 479 VLKDFSLTLRPGQTVALVGASGSGKSTIASLVERFYEPSAGNIKL 523


>AY060964-1|AAL28512.1|  709|Drosophila melanogaster GM09415p
           protein.
          Length = 709

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +D+KI +   +   S L Q+ +L +N G    L GL     S++ AAL   ++P  EH++
Sbjct: 15  KDVKIVDCETS---SSLQQEEVLLVN-GVPVKLDGLPADDASAIKAALLEGQMPSVEHLN 70

Query: 440 IFHLTRGGARYPI 478
                 G A+ PI
Sbjct: 71  QLLFRAGLAQQPI 83


>AE014298-1785|AAF48177.1|  761|Drosophila melanogaster CG1824-PA
           protein.
          Length = 761

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +L+D  L L  G+   LVG +G GKS++ + + R   P   +I +
Sbjct: 479 VLKDFSLTLRPGQTVALVGASGSGKSTIASLVERFYEPSAGNIKL 523


>AE013599-2492|AAM70883.1|  709|Drosophila melanogaster CG4853-PB,
           isoform B protein.
          Length = 709

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +D+KI +   +   S L Q+ +L +N G    L GL     S++ AAL   ++P  EH++
Sbjct: 15  KDVKIVDCETS---SSLQQEEVLLVN-GVPVKLDGLPADDASAIKAALLEGQMPSVEHLN 70

Query: 440 IFHLTRGGARYPI 478
                 G A+ PI
Sbjct: 71  QLLFRAGLAQQPI 83


>AE013599-2491|AAF57849.2|  709|Drosophila melanogaster CG4853-PA,
           isoform A protein.
          Length = 709

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +D+KI +   +   S L Q+ +L +N G    L GL     S++ AAL   ++P  EH++
Sbjct: 15  KDVKIVDCETS---SSLQQEEVLLVN-GVPVKLDGLPADDASAIKAALLEGQMPSVEHLN 70

Query: 440 IFHLTRGGARYPI 478
                 G A+ PI
Sbjct: 71  QLLFRAGLAQQPI 83


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,955,455
Number of Sequences: 53049
Number of extensions: 526796
Number of successful extensions: 1593
Number of sequences better than 10.0: 68
Number of HSP's better than 10.0 without gapping: 1433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1593
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2358819486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).