SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070937-1|AAL48559.1|  383|Drosophila melanogaster RE03627p pro...    31   1.6  
AE014134-3156|AAG22443.2|  383|Drosophila melanogaster CG10628-P...    31   1.6  
BT024218-1|ABC86280.1|  544|Drosophila melanogaster RE08574p pro...    28   8.6  
AE014134-2481|AAO41192.2|  948|Drosophila melanogaster CG33090-P...    28   8.6  

>AY070937-1|AAL48559.1|  383|Drosophila melanogaster RE03627p
           protein.
          Length = 383

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%)
 Frame = -1

Query: 528 PGCVENAFLFFVQFHLFENHKTHTRFYIFKFDSFN-DSSPRH 406
           PG +E A   F   H F  H   TR  +F  D F    SP+H
Sbjct: 213 PGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKH 254


>AE014134-3156|AAG22443.2|  383|Drosophila melanogaster CG10628-PA
           protein.
          Length = 383

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%)
 Frame = -1

Query: 528 PGCVENAFLFFVQFHLFENHKTHTRFYIFKFDSFN-DSSPRH 406
           PG +E A   F   H F  H   TR  +F  D F    SP+H
Sbjct: 213 PGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKH 254


>BT024218-1|ABC86280.1|  544|Drosophila melanogaster RE08574p
           protein.
          Length = 544

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 468 KTHTRFYIFKFDSFNDSSPR 409
           +THTR+Y   FD   DS PR
Sbjct: 414 QTHTRYYTKYFDDSGDSGPR 433


>AE014134-2481|AAO41192.2|  948|Drosophila melanogaster CG33090-PB
           protein.
          Length = 948

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 468 KTHTRFYIFKFDSFNDSSPR 409
           +THTR+Y   FD   DS PR
Sbjct: 414 QTHTRYYTKYFDDSGDSGPR 433


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,763,885
Number of Sequences: 53049
Number of extensions: 592243
Number of successful extensions: 1175
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1175
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2482967880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).