SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro...    29   5.6  
BT010124-1|AAQ22593.1|  594|Drosophila melanogaster AT11375p pro...    28   9.7  
AE014298-3068|AAF50869.1|  594|Drosophila melanogaster CG10998-P...    28   9.7  

>BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p
           protein.
          Length = 1273

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = -1

Query: 429 EDMSGNAYDVFKP-ETFLKSCPQSTQAILKNVSIT*NITLSTVVLP*TLQ 283
           E  +  A D+F   +  L SCP+ T+A+ + V  T +++LST +   T++
Sbjct: 7   EKQAAAALDIFNGIKEQLSSCPERTRALCRTVWGTLSLSLSTALQAATIE 56


>BT010124-1|AAQ22593.1|  594|Drosophila melanogaster AT11375p
           protein.
          Length = 594

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -2

Query: 473 FLNSLPFYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQYLKTSVLH 327
           F+ SL + Q  +E  + C      FLS  L  +    +HK   +T VL+
Sbjct: 470 FVQSLSYAQKAIEEARVCNSLIWEFLSTMLMAKSHAVLHKYERQTEVLN 518


>AE014298-3068|AAF50869.1|  594|Drosophila melanogaster CG10998-PA,
           isoform A protein.
          Length = 594

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -2

Query: 473 FLNSLPFYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQYLKTSVLH 327
           F+ SL + Q  +E  + C      FLS  L  +    +HK   +T VL+
Sbjct: 470 FVQSLSYAQKAIEEARVCNSLIWEFLSTMLMAKSHAVLHKYERQTEVLN 518


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,079,314
Number of Sequences: 53049
Number of extensions: 413306
Number of successful extensions: 799
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 789
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 799
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2131214097
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).