SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   157   1e-38
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   157   1e-38
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   157   1e-38
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   157   1e-38
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   157   1e-38
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   157   1e-38
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   157   1e-38
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   157   1e-38
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   157   1e-38
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   156   2e-38
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   156   2e-38
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   156   2e-38
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   156   2e-38
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   156   2e-38
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   156   2e-38
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   156   2e-38
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   156   2e-38
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   152   4e-37
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   152   4e-37
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   152   4e-37
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   152   4e-37
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   151   7e-37
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   151   7e-37
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   151   7e-37
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    151   7e-37
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   124   9e-29
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   124   9e-29
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   105   6e-23
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   100   3e-21
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...    97   2e-20
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...    97   2e-20
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...    81   1e-15
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...    81   1e-15
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...    81   1e-15
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    56   5e-08
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    55   6e-08
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    55   6e-08
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    38   0.014
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    38   0.014
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    36   0.032
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    35   0.074
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    35   0.074
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.52 
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    31   1.6  
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    31   1.6  
AY070574-1|AAL48045.1|  328|Drosophila melanogaster RE11768p pro...    30   2.8  
AE014297-4001|AAF56629.1|  328|Drosophila melanogaster CG5491-PA...    30   2.8  
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   3.7  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   3.7  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   3.7  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   3.7  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   3.7  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   3.7  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   3.7  
AE014297-716|AAF54204.1|  520|Drosophila melanogaster CG7549-PA,...    29   6.4  
AE014297-715|ABI31146.1|  563|Drosophila melanogaster CG7549-PC,...    29   6.4  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   8.4  
M95811-1|AAD19752.1| 1788|Drosophila melanogaster laminin B1 cha...    28   8.4  
M19525-1|AAA28663.1| 1788|Drosophila melanogaster protein ( D.me...    28   8.4  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   8.4  
BT015222-1|AAT94451.1| 1296|Drosophila melanogaster RE35801p pro...    28   8.4  
AY095001-1|AAM11329.1| 1026|Drosophila melanogaster GH02457p pro...    28   8.4  
AE014134-1348|AAN10647.1| 1788|Drosophila melanogaster CG7123-PB...    28   8.4  
AE014134-1347|AAF52563.1| 1788|Drosophila melanogaster CG7123-PA...    28   8.4  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  157 bits (381), Expect = 1e-38
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 1e-22
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNAPAM 133



 Score =  101 bits (243), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  156 bits (378), Expect = 2e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  152 bits (368), Expect = 4e-37
 Identities = 80/134 (59%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVG   +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  100 bits (239), Expect = 2e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+LKYPIEHGI+TNWDDMEK+WHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  152 bits (368), Expect = 4e-37
 Identities = 80/134 (59%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVG   +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  100 bits (239), Expect = 2e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+LKYPIEHGI+TNWDDMEK+WHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  152 bits (368), Expect = 4e-37
 Identities = 80/134 (59%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVG   +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  100 bits (239), Expect = 2e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+LKYPIEHGI+TNWDDMEK+WHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  152 bits (368), Expect = 4e-37
 Identities = 80/134 (59%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVG   +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  100 bits (239), Expect = 2e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+LKYPIEHGI+TNWDDMEK+WHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  151 bits (366), Expect = 7e-37
 Identities = 78/134 (58%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  151 bits (366), Expect = 7e-37
 Identities = 78/134 (58%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  151 bits (366), Expect = 7e-37
 Identities = 78/134 (58%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  151 bits (366), Expect = 7e-37
 Identities = 78/134 (58%), Positives = 86/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  124 bits (299), Expect = 9e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AK 271
           +K
Sbjct: 61  SK 62



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 26/27 (96%), Positives = 26/27 (96%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDME 336
           EAQSKRG LTLKYPIEHGIVTNWDDME
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDME 84


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  124 bits (299), Expect = 9e-29
 Identities = 67/118 (56%), Positives = 72/118 (61%)
 Frame = +2

Query: 134 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXX 313
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K              
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 314 XLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
                   +             PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 61  ITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ETFNSPAM 117



 Score =  102 bits (244), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 42  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 101

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 102 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 145


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  105 bits (251), Expect = 6e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 229
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48



 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 64  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNAPAM 98



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 34/81 (41%), Positives = 40/81 (49%)
 Frame = +1

Query: 331 MEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTV 510
           MEKIWHHTFYNEL VAP   P         P+ +REK     + +TF  P    V IQ V
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNAPA-MYVAIQAV 105

Query: 511 LLAFTPFRGRYPTRDSRLGLS 573
           L  +   R      DS  G+S
Sbjct: 106 LSLYASGRTTGIVLDSGDGVS 126


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 58/129 (44%), Positives = 72/129 (55%), Gaps = 2/129 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXX 283
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G R   K    
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEKRGIL 71

Query: 284 XXXXXXXXXXXLTGMTWRRFGII-PSTMSWV-SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                           W    ++   T   + + P + P LLTEAPLNPK    KMT IM
Sbjct: 72  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 128

Query: 458 FPKHFTRPA 484
           F +HF  PA
Sbjct: 129 F-EHFQVPA 136



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 30/58 (51%), Positives = 36/58 (62%)
 Frame = +1

Query: 268 KRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           KRG LTLKYPIEHG+V NWD+ME +W HT Y  L   P   P+        P+ +REK
Sbjct: 67  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREK 123


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 57/129 (44%), Positives = 71/129 (55%), Gaps = 2/129 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXX 283
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G     K    
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 63

Query: 284 XXXXXXXXXXXLTGMTWRRFGII-PSTMSWV-SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                           W    ++   T   + + P + P LLTEAPLNPK    KMT IM
Sbjct: 64  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 120

Query: 458 FPKHFTRPA 484
           F +HF  PA
Sbjct: 121 F-EHFQVPA 128



 Score = 64.9 bits (151), Expect = 8e-11
 Identities = 31/61 (50%), Positives = 37/61 (60%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHRE 438
           A  KRG LTLKYPIEHG+V NWD+ME +W HT Y  L   P   P+        P+ +RE
Sbjct: 56  AARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNRE 114

Query: 439 K 441
           K
Sbjct: 115 K 115


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 57/129 (44%), Positives = 71/129 (55%), Gaps = 2/129 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXX 283
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G     K    
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 71

Query: 284 XXXXXXXXXXXLTGMTWRRFGII-PSTMSWV-SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                           W    ++   T   + + P + P LLTEAPLNPK    KMT IM
Sbjct: 72  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 128

Query: 458 FPKHFTRPA 484
           F +HF  PA
Sbjct: 129 F-EHFQVPA 136



 Score = 64.9 bits (151), Expect = 8e-11
 Identities = 31/61 (50%), Positives = 37/61 (60%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHRE 438
           A  KRG LTLKYPIEHG+V NWD+ME +W HT Y  L   P   P+        P+ +RE
Sbjct: 64  AARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNRE 122

Query: 439 K 441
           K
Sbjct: 123 K 123


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 51/146 (34%), Positives = 69/146 (47%), Gaps = 1/146 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +          
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  I S     +  E+HPVLLTEAPLNP+    K     F +
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFF-E 130

Query: 467 HFTRPAIVPSAFKPCFLLLHRFGAVT 544
               PA+  S      L L+  G VT
Sbjct: 131 GINAPALFVS--MQAVLSLYATGRVT 154


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 51/146 (34%), Positives = 69/146 (47%), Gaps = 1/146 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +          
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  I S     +  E+HPVLLTEAPLNP+    K     F +
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFF-E 130

Query: 467 HFTRPAIVPSAFKPCFLLLHRFGAVT 544
               PA+  S      L L+  G VT
Sbjct: 131 GINAPALFVS--MQAVLSLYATGRVT 154


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 51/146 (34%), Positives = 69/146 (47%), Gaps = 1/146 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +          
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  I S     +  E+HPVLLTEAPLNP+    K     F +
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFF-E 130

Query: 467 HFTRPAIVPSAFKPCFLLLHRFGAVT 544
               PA+  S      L L+  G VT
Sbjct: 131 GINAPALFVS--MQAVLSLYATGRVT 154


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 41/127 (32%), Positives = 58/127 (45%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VG     +R   
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 69

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  M     P    +LLTE P+NP     KM 
Sbjct: 70  EVSYPMENGVVRNWDDMCHVWEYTFG--PKKMD--IDPTNTKILLTEPPMNPTKNREKMI 125

Query: 449 HIMFPKH 469
            +MF K+
Sbjct: 126 EVMFEKY 132



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF-YNELGVAPRGTPS 396
           G    + L+   EA   R  L + YP+E+G+V NWDDM  +W +TF   ++ + P  T  
Sbjct: 49  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKI 108

Query: 397 PAH*GSPQPQGHREK 441
                   P  +REK
Sbjct: 109 LLTEPPMNPTKNREK 123


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 41/127 (32%), Positives = 58/127 (45%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VG     +R   
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  M     P    +LLTE P+NP     KM 
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFG--PKKMD--IDPTNTKILLTEPPMNPTKNREKMI 124

Query: 449 HIMFPKH 469
            +MF K+
Sbjct: 125 EVMFEKY 131



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF-YNELGVAPRGTPS 396
           G    + L+   EA   R  L + YP+E+G+V NWDDM  +W +TF   ++ + P  T  
Sbjct: 48  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKI 107

Query: 397 PAH*GSPQPQGHREK 441
                   P  +REK
Sbjct: 108 LLTEPPMNPTKNREK 122


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 41/127 (32%), Positives = 58/127 (45%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VG     +R   
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  M     P    +LLTE P+NP     KM 
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFG--PKKMD--IDPTNTKILLTEPPMNPTKNREKMI 124

Query: 449 HIMFPKH 469
            +MF K+
Sbjct: 125 EVMFEKY 131



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF-YNELGVAPRGTPS 396
           G    + L+   EA   R  L + YP+E+G+V NWDDM  +W +TF   ++ + P  T  
Sbjct: 48  GDIEVKDLMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKI 107

Query: 397 PAH*GSPQPQGHREK 441
                   P  +REK
Sbjct: 108 LLTEPPMNPTKNREK 122


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 374 SPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
           S PE HPVL +EA  N +    K+T +MF K+
Sbjct: 118 SEPEYHPVLFSEASWNVRNNREKLTELMFEKY 149


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44



 Score = 35.5 bits (78), Expect = 0.056
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 374 SPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
           S PE HPVL +EA  N +    K+T +MF K+
Sbjct: 118 SEPEYHPVLFSEASWNVRNNREKLTELMFEKY 149


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 36.3 bits (80), Expect = 0.032
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  + G+ ++KYP+ HG+V +WD ME+      +  L   P
Sbjct: 65  EAFDRTGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEP 105



 Score = 34.7 bits (76), Expect = 0.097
 Identities = 32/127 (25%), Positives = 48/127 (37%), Gaps = 9/127 (7%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++G   
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIG--D 64

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWV-SPPEEHPVLLTEAPLNPKATER 439
            A                +         +      ++ + PE+H  LLTE PLN      
Sbjct: 65  EAFDRTGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124

Query: 440 KMTHIMF 460
               IMF
Sbjct: 125 YTAEIMF 131


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 35.1 bits (77), Expect = 0.074
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA    G+ ++KYP+ HG+V +WD ME+      +  L   P
Sbjct: 65  EAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEP 105



 Score = 34.7 bits (76), Expect = 0.097
 Identities = 32/127 (25%), Positives = 48/127 (37%), Gaps = 9/127 (7%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++G   
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIG--D 64

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWV-SPPEEHPVLLTEAPLNPKATER 439
            A                +         +      ++ + PE+H  LLTE PLN      
Sbjct: 65  EAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124

Query: 440 KMTHIMF 460
               IMF
Sbjct: 125 YTAEIMF 131


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 35.1 bits (77), Expect = 0.074
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA    G+ ++KYP+ HG+V +WD ME+      +  L   P
Sbjct: 65  EAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEP 105



 Score = 34.7 bits (76), Expect = 0.097
 Identities = 32/127 (25%), Positives = 48/127 (37%), Gaps = 9/127 (7%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++G   
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIG--D 64

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWV-SPPEEHPVLLTEAPLNPKATER 439
            A                +         +      ++ + PE+H  LLTE PLN      
Sbjct: 65  EAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124

Query: 440 KMTHIMF 460
               IMF
Sbjct: 125 YTAEIMF 131


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.52
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGS 130
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38



 Score = 29.9 bits (64), Expect = 2.8
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTF 357
           LK P E  ++TNW+  E+I+ + F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIF 102



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +2

Query: 386 EHPVLLTEAPLNPKATERKMTHIMF 460
           +HP++LTEA  NP    ++M  ++F
Sbjct: 114 DHPIILTEALANPNFCRQQMNELLF 138


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38



 Score = 29.9 bits (64), Expect = 2.8
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTF 357
           LK P E  ++TNW+  E+I+ + F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIF 102



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +2

Query: 386 EHPVLLTEAPLNPKATERKMTHIMF 460
           +HP++LTEA  NP    ++M  ++F
Sbjct: 114 DHPIILTEALANPNFCRQQMNELLF 138


>AY070574-1|AAL48045.1|  328|Drosophila melanogaster RE11768p
           protein.
          Length = 328

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = -1

Query: 285 GQETSFALCLTPT*E-SFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTN 109
           G+ TS A  +TPT   +  P+P  +     + +   + +  +SSP     + PEP S+TN
Sbjct: 190 GRTTSSAAAVTPTVFIADEPMPLTSKAKSSVASSRSSNSSNSSSP----FYRPEPSSSTN 245

Query: 108 AATSSS 91
           A++SSS
Sbjct: 246 ASSSSS 251


>AE014297-4001|AAF56629.1|  328|Drosophila melanogaster CG5491-PA
           protein.
          Length = 328

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = -1

Query: 285 GQETSFALCLTPT*E-SFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTN 109
           G+ TS A  +TPT   +  P+P  +     + +   + +  +SSP     + PEP S+TN
Sbjct: 190 GRTTSSAAAVTPTVFIADEPMPLTSKAKSSVASSRSSNSSNSSSP----FYRPEPSSSTN 245

Query: 108 AATSSS 91
           A++SSS
Sbjct: 246 ASSSSS 251


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181 PLDRGKAPPSGRDGRYGTEGL 243
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +1

Query: 181  PLDRGKAPPSGRDGRYGTEGL 243
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014297-716|AAF54204.1|  520|Drosophila melanogaster CG7549-PA,
           isoform A protein.
          Length = 520

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +2

Query: 344 GIIPSTMSWVSPPEEHPVLLTEAPLNPKAT 433
           G++PST   V+PP +HP  L E  ++ ++T
Sbjct: 56  GVLPSTQQQVNPPVQHP--LPEKRISSRST 83


>AE014297-715|ABI31146.1|  563|Drosophila melanogaster CG7549-PC,
           isoform C protein.
          Length = 563

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +2

Query: 344 GIIPSTMSWVSPPEEHPVLLTEAPLNPKAT 433
           G++PST   V+PP +HP  L E  ++ ++T
Sbjct: 99  GVLPSTQQQVNPPVQHP--LPEKRISSRST 126


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 86  MCDEEVAALVVD 121
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M95811-1|AAD19752.1| 1788|Drosophila melanogaster laminin B1 chain
            protein.
          Length = 1788

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499  CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
            C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 1005 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 1063

Query: 337  SPCHPS 320
             PC P+
Sbjct: 1064 CPCLPN 1069


>M19525-1|AAA28663.1| 1788|Drosophila melanogaster protein (
            D.melanogaster lamininB1 subunit mRNA, complete cds. ).
          Length = 1788

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499  CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
            C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 1005 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 1063

Query: 337  SPCHPS 320
             PC P+
Sbjct: 1064 CPCLPN 1069


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 86  MCDEEVAALVVD 121
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>BT015222-1|AAT94451.1| 1296|Drosophila melanogaster RE35801p
           protein.
          Length = 1296

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499 CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
           C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 513 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 571

Query: 337 SPCHPS 320
            PC P+
Sbjct: 572 CPCLPN 577


>AY095001-1|AAM11329.1| 1026|Drosophila melanogaster GH02457p
           protein.
          Length = 1026

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499 CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
           C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 243 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 301

Query: 337 SPCHPS 320
            PC P+
Sbjct: 302 CPCLPN 307


>AE014134-1348|AAN10647.1| 1788|Drosophila melanogaster CG7123-PB,
            isoform B protein.
          Length = 1788

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499  CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
            C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 1005 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 1063

Query: 337  SPCHPS 320
             PC P+
Sbjct: 1064 CPCLPN 1069


>AE014134-1347|AAF52563.1| 1788|Drosophila melanogaster CG7123-PA,
            isoform A protein.
          Length = 1788

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 6/66 (9%)
 Frame = -3

Query: 499  CRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQ-----DWVFLGGRHP-AHCRRYDAKS 338
            C R  G   K  ++    H  LC  G  G   +Q     +  FLG  +  AHC R+  + 
Sbjct: 1005 CDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQ- 1063

Query: 337  SPCHPS 320
             PC P+
Sbjct: 1064 CPCLPN 1069


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,684,824
Number of Sequences: 53049
Number of extensions: 895257
Number of successful extensions: 2856
Number of sequences better than 10.0: 64
Number of HSP's better than 10.0 without gapping: 2536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2824
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2441585082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).