SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0005
         (609 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118389-1|AAM48418.1|  347|Drosophila melanogaster RE38650p pro...    29   5.0  
AE013599-1055|AAF58818.2|  347|Drosophila melanogaster CG12911-P...    29   5.0  
BT022892-1|AAY55308.1|  425|Drosophila melanogaster IP12506p pro...    28   8.7  
BT022218-1|AAY54634.1|  423|Drosophila melanogaster IP12406p pro...    28   8.7  
BT012441-1|AAS93712.1| 1423|Drosophila melanogaster RH07858p pro...    28   8.7  
AY094729-1|AAM11082.1|  723|Drosophila melanogaster GH24458p pro...    28   8.7  
AE014297-1318|AAN13511.1|  157|Drosophila melanogaster CG6783-PC...    28   8.7  
AE014134-2652|AAF53491.2|  427|Drosophila melanogaster CG31821-P...    28   8.7  
AE013599-3832|AAF47176.3| 1423|Drosophila melanogaster CG3328-PA...    28   8.7  

>AY118389-1|AAM48418.1|  347|Drosophila melanogaster RE38650p
           protein.
          Length = 347

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 7   TSGSPRLAGNSAAGGSREKERETE 78
           +SGS   + +S +GGSRE+ERE +
Sbjct: 299 SSGSSSSSSSSGSGGSRERERERD 322


>AE013599-1055|AAF58818.2|  347|Drosophila melanogaster CG12911-PA
           protein.
          Length = 347

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 7   TSGSPRLAGNSAAGGSREKERETE 78
           +SGS   + +S +GGSRE+ERE +
Sbjct: 299 SSGSSSSSSSSGSGGSRERERERD 322


>BT022892-1|AAY55308.1|  425|Drosophila melanogaster IP12506p
           protein.
          Length = 425

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -2

Query: 545 YAKYVSASVFFKRQLFQNLINLCMFFFKLHRCVDDLTAHLVLSGY 411
           YA   S  V    +L  +LI+  + F+KLH+   ++  H+    Y
Sbjct: 113 YADNTSLLVTNNEELIDDLISFMLHFYKLHKEFKNVPLHIFSESY 157


>BT022218-1|AAY54634.1|  423|Drosophila melanogaster IP12406p
           protein.
          Length = 423

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -2

Query: 545 YAKYVSASVFFKRQLFQNLINLCMFFFKLHRCVDDLTAHLVLSGY 411
           YA   S  V    +L  +LI+  + F+KLH+   ++  H+    Y
Sbjct: 111 YADNTSLLVTNNEELIDDLISFMLHFYKLHKEFKNVPLHIFSESY 155


>BT012441-1|AAS93712.1| 1423|Drosophila melanogaster RH07858p
           protein.
          Length = 1423

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = -1

Query: 345 GIVTTAAPPFKPKHITASRQKW 280
           G++TT AP F  K I++ + KW
Sbjct: 892 GVITTTAPRFSNKTISSKKGKW 913


>AY094729-1|AAM11082.1|  723|Drosophila melanogaster GH24458p
           protein.
          Length = 723

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = -1

Query: 345 GIVTTAAPPFKPKHITASRQKW 280
           G++TT AP F  K I++ + KW
Sbjct: 192 GVITTTAPRFSNKTISSKKGKW 213


>AE014297-1318|AAN13511.1|  157|Drosophila melanogaster CG6783-PC,
           isoform C protein.
          Length = 157

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 11/17 (64%), Positives = 13/17 (76%)
 Frame = -1

Query: 54  GSARRRIPCQPGGPTSL 4
           GS R R+PCQP  PTS+
Sbjct: 125 GSLRLRVPCQPVPPTSV 141


>AE014134-2652|AAF53491.2|  427|Drosophila melanogaster CG31821-PA
           protein.
          Length = 427

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -2

Query: 545 YAKYVSASVFFKRQLFQNLINLCMFFFKLHRCVDDLTAHLVLSGY 411
           YA   S  V    +L  +LI+  + F+KLH+   ++  H+    Y
Sbjct: 115 YADNTSLLVTNNEELIDDLISFMLHFYKLHKEFKNVPLHIFSESY 159


>AE013599-3832|AAF47176.3| 1423|Drosophila melanogaster CG3328-PA
           protein.
          Length = 1423

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = -1

Query: 345 GIVTTAAPPFKPKHITASRQKW 280
           G++TT AP F  K I++ + KW
Sbjct: 892 GVITTTAPRFSNKTISSKKGKW 913


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,564,828
Number of Sequences: 53049
Number of extensions: 600469
Number of successful extensions: 1217
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1175
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1217
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2503659279
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).