SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   155   4e-38
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   155   4e-38
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   155   4e-38
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   155   4e-38
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   155   4e-38
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   155   4e-38
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   155   4e-38
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   155   4e-38
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   155   4e-38
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   153   3e-37
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   153   3e-37
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   152   3e-37
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   152   3e-37
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   152   3e-37
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   152   3e-37
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   152   3e-37
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   152   3e-37
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   149   4e-36
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   149   4e-36
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   149   4e-36
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   149   4e-36
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   148   7e-36
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   148   7e-36
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   148   7e-36
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    148   7e-36
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   137   1e-32
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   122   3e-28
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   105   7e-23
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...    89   5e-18
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...    89   5e-18
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...    88   8e-18
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...    81   1e-15
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...    81   1e-15
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...    81   1e-15
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    62   5e-10
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    62   6e-10
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    62   6e-10
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    57   2e-08
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    57   2e-08
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    57   2e-08
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    52   5e-07
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    52   5e-07
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    40   0.002
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    40   0.002
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.57 
M20239-1|AAA28865.1|  155|Drosophila melanogaster protein ( D.me...    30   3.0  
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   4.0  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   4.0  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   4.0  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   4.0  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   4.0  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   4.0  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   4.0  
AE013599-1731|AAF58365.1|  950|Drosophila melanogaster CG6061-PA...    29   4.0  
AY118537-1|AAM49906.1|  587|Drosophila melanogaster LD26982p pro...    29   5.3  
AE014134-216|AAF51404.1|  587|Drosophila melanogaster CG4785-PA ...    29   5.3  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   9.2  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   9.2  
AY061141-1|AAL28689.1|  582|Drosophila melanogaster LD12022p pro...    28   9.2  
AF247501-1|AAF63389.1|  582|Drosophila melanogaster PINEAPPLE EY...    28   9.2  
AF244353-1|AAF82476.1|  117|Drosophila melanogaster 4E-binding p...    28   9.2  
AF132557-1|AAD27856.1|  117|Drosophila melanogaster HL08053p pro...    28   9.2  
AE014134-1879|AAF52945.1|  582|Drosophila melanogaster CG5354-PA...    28   9.2  
AE014134-614|AAF51100.1|  117|Drosophila melanogaster CG8846-PA ...    28   9.2  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  155 bits (377), Expect = 4e-38
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 2e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  153 bits (370), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  153 bits (370), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  152 bits (369), Expect = 3e-37
 Identities = 79/131 (60%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNAP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  149 bits (360), Expect = 4e-36
 Identities = 77/131 (58%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  120 bits (290), Expect = 1e-27
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  149 bits (360), Expect = 4e-36
 Identities = 77/131 (58%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  120 bits (290), Expect = 1e-27
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  149 bits (360), Expect = 4e-36
 Identities = 77/131 (58%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  120 bits (290), Expect = 1e-27
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  149 bits (360), Expect = 4e-36
 Identities = 77/131 (58%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  120 bits (290), Expect = 1e-27
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  148 bits (358), Expect = 7e-36
 Identities = 75/131 (57%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  148 bits (358), Expect = 7e-36
 Identities = 75/131 (57%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  148 bits (358), Expect = 7e-36
 Identities = 75/131 (57%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  148 bits (358), Expect = 7e-36
 Identities = 75/131 (57%), Positives = 81/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  137 bits (331), Expect = 1e-32
 Identities = 63/63 (100%), Positives = 63/63 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKR 254
           SKR
Sbjct: 61  SKR 63



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 20/23 (86%), Positives = 22/23 (95%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDME 316
           ++ ILTLKYPIEHGIVTNWDDME
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDME 84


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  122 bits (295), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 46  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 103



 Score =  121 bits (291), Expect = 9e-28
 Identities = 64/115 (55%), Positives = 67/115 (58%)
 Frame = +3

Query: 114 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXX 293
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR             
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 294 XLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                   +             P      L   P  P+A   KMTQIMFETFN+P
Sbjct: 61  ITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSP 115


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  105 bits (251), Expect = 7e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 209
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48



 Score = 81.4 bits (192), Expect = 9e-16
 Identities = 35/37 (94%), Positives = 35/37 (94%)
 Frame = +2

Query: 311 MEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           MEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 84



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 17/33 (51%), Positives = 18/33 (54%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFN P
Sbjct: 64  PEEHPVLLTEAPLNPKANREKMTQIMFETFNAP 96


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 50/127 (39%), Positives = 67/127 (52%), Gaps = 2/127 (1%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KR   
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 63

Query: 264 XXXXXXXXXXXLTGMTWRRFGII-PSTMSCV-SPPRNTQSCLLRLPSTPRATERKMTQIM 437
                           W    ++   T   + + P +  + L   P  P+    KMT+IM
Sbjct: 64  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 120

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 121 FEHFQVP 127



 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 38/58 (65%), Positives = 44/58 (75%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEA LNPK NREK
Sbjct: 59  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREK 115


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 50/127 (39%), Positives = 67/127 (52%), Gaps = 2/127 (1%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KR   
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 71

Query: 264 XXXXXXXXXXXLTGMTWRRFGII-PSTMSCV-SPPRNTQSCLLRLPSTPRATERKMTQIM 437
                           W    ++   T   + + P +  + L   P  P+    KMT+IM
Sbjct: 72  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 128

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 129 FEHFQVP 135



 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 38/58 (65%), Positives = 44/58 (75%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEA LNPK NREK
Sbjct: 67  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREK 123


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 88.2 bits (209), Expect = 8e-18
 Identities = 45/86 (52%), Positives = 53/86 (61%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKD 424
           E++ ILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEA LNPK NREK 
Sbjct: 66  EKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKM 124

Query: 425 DPDHVRNI*HAPPCTFGIQARASRCT 502
                 +    P     +QA  S CT
Sbjct: 125 TEIMFEHF-QVPAFYVAVQAVLSLCT 149



 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 49/127 (38%), Positives = 66/127 (51%), Gaps = 2/127 (1%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KR   
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEKRGIL 71

Query: 264 XXXXXXXXXXXLTGMTWRRFGII-PSTMSCV-SPPRNTQSCLLRLPSTPRATERKMTQIM 437
                           W    ++   T   + + P +  + L   P  P+    KMT+IM
Sbjct: 72  TLKYPIEHGMV---KNWDEMEMVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIM 128

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 129 FEHFQVP 135


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 34/60 (56%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEA LNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  I S     +   +    L   P  PR    K  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 447 FNTP 458
            N P
Sbjct: 132 INAP 135


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 34/60 (56%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEA LNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  I S     +   +    L   P  PR    K  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 447 FNTP 458
            N P
Sbjct: 132 INAP 135


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 34/60 (56%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEA LNP+ NREK
Sbjct: 64  EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREK 123



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  I S     +   +    L   P  PR    K  +  FE 
Sbjct: 72  RYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEG 131

Query: 447 FNTP 458
            N P
Sbjct: 132 INAP 135


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 26/61 (42%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++ +S+L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE  +NP  NRE
Sbjct: 63  SQLRSLLEVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 122

Query: 419 K 421
           K
Sbjct: 123 K 123



 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 44/127 (34%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKR--- 254
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R   
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 69

Query: 255 -VXXXXXXXXXXXXXLTGMTWR-RFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMT 428
            V                  W   FG  P  M     P NT+  L   P  P     KM 
Sbjct: 70  EVSYPMENGVVRNWDDMCHVWEYTFG--PKKMDI--DPTNTKILLTEPPMNPTKNREKMI 125

Query: 429 QIMFETF 449
           ++MFE +
Sbjct: 126 EVMFEKY 132


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 62.1 bits (144), Expect = 6e-10
 Identities = 26/61 (42%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++ +S+L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE  +NP  NRE
Sbjct: 62  SQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 44/127 (34%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKR--- 254
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R   
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 255 -VXXXXXXXXXXXXXLTGMTW-RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMT 428
            V                  W   FG  P  M     P NT+  L   P  P     KM 
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFG--PKKMDI--DPTNTKILLTEPPMNPTKNREKMI 124

Query: 429 QIMFETF 449
           ++MFE +
Sbjct: 125 EVMFEKY 131


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 62.1 bits (144), Expect = 6e-10
 Identities = 26/61 (42%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++ +S+L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE  +NP  NRE
Sbjct: 62  SQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 44/127 (34%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKR--- 254
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R   
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 255 -VXXXXXXXXXXXXXLTGMTW-RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMT 428
            V                  W   FG  P  M     P NT+  L   P  P     KM 
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFG--PKKMDI--DPTNTKILLTEPPMNPTKNREKMI 124

Query: 429 QIMFETF 449
           ++MFE +
Sbjct: 125 EVMFEKY 131


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 37/133 (27%), Positives = 51/133 (38%), Gaps = 9/133 (6%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
              R                     RF +       +         LL  P       R+
Sbjct: 67  -FDRTGYSIKYPVRHGLVEDWDLMERF-LEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124

Query: 423 MT-QIMFETFNTP 458
            T +IMFETFN P
Sbjct: 125 YTAEIMFETFNVP 137


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 23/60 (38%), Positives = 38/60 (63%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           T  +S + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EAS N + NREK
Sbjct: 81  TVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREK 140



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 23/60 (38%), Positives = 38/60 (63%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           T  +S + ++  ++ G++ NWD  EK+  + + N ++  PE HPVL +EAS N + NREK
Sbjct: 81  TVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREK 140



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEASLNPKGNREK 421
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQ 132



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEASLNPKGNREK 421
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQ 132



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.57
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGS 110
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>M20239-1|AAA28865.1|  155|Drosophila melanogaster protein (
           D.melanogaster RPII215gene encoding RNA polymerase II
           subunit, 5' end; P elementinsertion. ).
          Length = 155

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/69 (30%), Positives = 30/69 (43%)
 Frame = +3

Query: 417 RKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVPPGIRAGTSREPVFFHNPCPILPKGIP 596
           R +TQ  ++T NT    R   K  L    LP+ PP + +     P    +  P L  G+ 
Sbjct: 10  RCLTQTQYDTQNTIPFTRTYCKHTLSGCLLPTGPPYVISSWPSVPATNSDCLPSLLFGLS 69

Query: 597 HFSPTPISL 623
            FS +  SL
Sbjct: 70  RFSSSFFSL 78


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161 PLDRGKAPPSGRDGRYGTEGL 223
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 161  PLDRGKAPPSGRDGRYGTEGL 223
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE013599-1731|AAF58365.1|  950|Drosophila melanogaster CG6061-PA
           protein.
          Length = 950

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 9/25 (36%), Positives = 18/25 (72%)
 Frame = +3

Query: 483 PVLLAVRLPSVPPGIRAGTSREPVF 557
           P+ +  +LP++PPG++A    +P+F
Sbjct: 689 PIKVEPKLPTLPPGVKANVPAKPLF 713


>AY118537-1|AAM49906.1|  587|Drosophila melanogaster LD26982p
           protein.
          Length = 587

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 9/19 (47%), Positives = 16/19 (84%)
 Frame = -2

Query: 552 PVPGKSQHEYRVVRTEGVQ 496
           PVPG+++H Y+ + T+G+Q
Sbjct: 16  PVPGRNEHTYQSLATKGIQ 34


>AE014134-216|AAF51404.1|  587|Drosophila melanogaster CG4785-PA
           protein.
          Length = 587

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 9/19 (47%), Positives = 16/19 (84%)
 Frame = -2

Query: 552 PVPGKSQHEYRVVRTEGVQ 496
           PVPG+++H Y+ + T+G+Q
Sbjct: 16  PVPGRNEHTYQSLATKGIQ 34


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
           protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVD 101
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
           D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVD 101
           MCDEEVAALVVD
Sbjct: 1   MCDEEVAALVVD 12


>AY061141-1|AAL28689.1|  582|Drosophila melanogaster LD12022p
           protein.
          Length = 582

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 330 IPSTMSC-VSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRL 506
           +P T +  V+P    Q+ L  +P +P+      TQ++ +TF+ P+    A   V  A   
Sbjct: 425 LPQTTAINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQA---VAKAPNS 481

Query: 507 PSVP 518
           PS+P
Sbjct: 482 PSLP 485


>AF247501-1|AAF63389.1|  582|Drosophila melanogaster PINEAPPLE EYE
           protein.
          Length = 582

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 330 IPSTMSC-VSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRL 506
           +P T +  V+P    Q+ L  +P +P+      TQ++ +TF++P+    A   V  A   
Sbjct: 425 LPQTTAINVNPELTQQTALNTIPHSPQPEASFPTQLVSQTFDSPQPQEQA---VAEAPNS 481

Query: 507 PSVP 518
           PS+P
Sbjct: 482 PSLP 485


>AF244353-1|AAF82476.1|  117|Drosophila melanogaster 4E-binding
           protein THOR protein.
          Length = 117

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL 473
           +PP N  SCLLR   TPR   RK   +  E     + +++
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFRKCVPVPTELIKQTKSLKI 107


>AF132557-1|AAD27856.1|  117|Drosophila melanogaster HL08053p
           protein.
          Length = 117

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL 473
           +PP N  SCLLR   TPR   RK   +  E     + +++
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFRKCVPVPTELIKQTKSLKI 107


>AE014134-1879|AAF52945.1|  582|Drosophila melanogaster CG5354-PA
           protein.
          Length = 582

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 330 IPSTMSC-VSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRL 506
           +P T +  V+P    Q+ L  +P +P+      TQ++ +TF+ P+    A   V  A   
Sbjct: 425 LPQTTAINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQA---VAKAPNS 481

Query: 507 PSVP 518
           PS+P
Sbjct: 482 PSLP 485


>AE014134-614|AAF51100.1|  117|Drosophila melanogaster CG8846-PA
           protein.
          Length = 117

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL 473
           +PP N  SCLLR   TPR   RK   +  E     + +++
Sbjct: 70  TPPSNVPSCLLR--GTPRTPFRKCVPVPTELIKQTKSLKI 107


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,694,743
Number of Sequences: 53049
Number of extensions: 927640
Number of successful extensions: 3133
Number of sequences better than 10.0: 64
Number of HSP's better than 10.0 without gapping: 2736
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3121
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).