SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04427-1|CAA28024.1|  541|Drosophila melanogaster yellow gene pr...    91   1e-18
AL023873-2|CAA19640.1|  541|Drosophila melanogaster EG:125H10.2,...    91   1e-18
AE014298-26|AAF45497.1|  541|Drosophila melanogaster CG3757-PA p...    91   1e-18
AY113601-1|AAM29606.1|  438|Drosophila melanogaster RH54244p pro...    81   1e-15
AE014134-2553|AAF53432.3|  438|Drosophila melanogaster CG4182-PA...    81   1e-15
AY071114-1|AAL48736.1|  358|Drosophila melanogaster RE16722p pro...    68   9e-12
AE014135-44|AAF59358.2|  463|Drosophila melanogaster CG1629-PA p...    68   9e-12
AY118575-1|AAM49944.1|  453|Drosophila melanogaster LD43175p pro...    60   2e-09
AF237613-1|AAF60328.1|  453|Drosophila melanogaster YELLOW-B pro...    60   2e-09
AE014134-2765|AAF53564.1|  453|Drosophila melanogaster CG17914-P...    60   2e-09
BT003613-1|AAO39616.1|  447|Drosophila melanogaster GH16592p pro...    47   2e-05
AE014297-1605|AAF54884.1|  429|Drosophila melanogaster CG18550-P...    47   2e-05
AY060728-1|AAL28276.1|  452|Drosophila melanogaster GH17451p pro...    47   2e-05
AE014297-1606|AAF54885.2|  452|Drosophila melanogaster CG8063-PA...    47   2e-05
BT003303-1|AAO25063.1|  432|Drosophila melanogaster GH10609p pro...    45   9e-05
AE013599-3589|AAF46992.2|  432|Drosophila melanogaster CG9889-PA...    45   9e-05
AY121706-1|AAM52033.1|  412|Drosophila melanogaster RH49821p pro...    42   7e-04
AE014297-1687|AAF54947.1|  426|Drosophila melanogaster CG17044-P...    42   7e-04
AE013599-3590|AAF46993.1|  412|Drosophila melanogaster CG9891-PA...    42   7e-04
AE014296-437|AAF47631.1|  393|Drosophila melanogaster CG5717-PA ...    38   0.014
AE014296-438|AAF47632.1|  382|Drosophila melanogaster CG13804-PA...    37   0.019
AY071489-1|AAL49111.1|  530|Drosophila melanogaster RE55542p pro...    32   0.53 
AE014297-1688|AAF54948.1|  530|Drosophila melanogaster CG9792-PA...    32   0.53 
U69607-1|AAD08845.1|  493|Drosophila melanogaster amylase-like p...    32   0.70 
AY052055-1|AAK93479.1|  493|Drosophila melanogaster LP08070p pro...    30   2.1  
AF022713-3|AAD09147.2|  493|Drosophila melanogaster putative amy...    30   2.1  
AE013599-2321|AAF57971.1|  493|Drosophila melanogaster CG8221-PA...    30   2.1  

>X04427-1|CAA28024.1|  541|Drosophila melanogaster yellow gene
           protein.
          Length = 541

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 52/68 (76%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+VPRWR G
Sbjct: 21  AAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDG 80

Query: 229 IPATLNYI 252
           IPATL YI
Sbjct: 81  IPATLTYI 88



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 252 SLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVF--RRLALMDTTT 425
           ++D     SP+L PYP +  N  G  +      Y  +K D+C RLWV     + + +TTT
Sbjct: 89  NMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYR-IKVDECGRLWVLDTGTVGIGNTTT 147

Query: 426 LPNGVAPYTLKCF 464
            P    PY +  F
Sbjct: 148 NP---CPYAVNVF 157


>AL023873-2|CAA19640.1|  541|Drosophila melanogaster
           EG:125H10.2,FBgn0004034;y protein.
          Length = 541

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 52/68 (76%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+VPRWR G
Sbjct: 21  AAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDG 80

Query: 229 IPATLNYI 252
           IPATL YI
Sbjct: 81  IPATLTYI 88



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 252 SLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVF--RRLALMDTTT 425
           ++D     SP+L PYP +  N  G  +      Y  +K D+C RLWV     + + +TTT
Sbjct: 89  NMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYR-IKVDECGRLWVLDTGTVGIGNTTT 147

Query: 426 LPNGVAPYTLKCF 464
            P    PY +  F
Sbjct: 148 NP---CPYAVNVF 157


>AE014298-26|AAF45497.1|  541|Drosophila melanogaster CG3757-PA
           protein.
          Length = 541

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 52/68 (76%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+VPRWR G
Sbjct: 21  AAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDG 80

Query: 229 IPATLNYI 252
           IPATL YI
Sbjct: 81  IPATLTYI 88



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 252 SLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVF--RRLALMDTTT 425
           ++D     SP+L PYP +  N  G  +      Y  +K D+C RLWV     + + +TTT
Sbjct: 89  NMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYR-IKVDECGRLWVLDTGTVGIGNTTT 147

Query: 426 LPNGVAPYTLKCF 464
            P    PY +  F
Sbjct: 148 NP---CPYAVNVF 157


>AY113601-1|AAM29606.1|  438|Drosophila melanogaster RH54244p
           protein.
          Length = 438

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 33/68 (48%), Positives = 51/68 (75%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW++G
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWKAG 82

Query: 229 IPATLNYI 252
           + ATLNYI
Sbjct: 83  VAATLNYI 90



 Score = 33.9 bits (74), Expect(2) = 6e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +3

Query: 168 RWYRKVEEQIVRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNEL 320
           RW  ++   + R ++ VA   + Y +++S     E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKAGVAATLN-YIDINST----EKSPKLHPYPSWEANKL 112



 Score = 27.5 bits (58), Expect(2) = 6e-04
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = +3

Query: 360 VKADQCDRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKLIRKNTLFTDPGKK 533
           ++ D CDRLWV     L D    P  + P ++   L  +     L+R+ T+  D  K+
Sbjct: 153 IQVDVCDRLWVL-DTGLADILGSPKQITPNSI---LVFDLKTDTLLRRFTIPADQTKE 206


>AE014134-2553|AAF53432.3|  438|Drosophila melanogaster CG4182-PA
           protein.
          Length = 438

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 33/68 (48%), Positives = 51/68 (75%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW++G
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWKAG 82

Query: 229 IPATLNYI 252
           + ATLNYI
Sbjct: 83  VAATLNYI 90



 Score = 33.9 bits (74), Expect(2) = 6e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +3

Query: 168 RWYRKVEEQIVRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNEL 320
           RW  ++   + R ++ VA   + Y +++S     E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKAGVAATLN-YIDINST----EKSPKLHPYPSWEANKL 112



 Score = 27.5 bits (58), Expect(2) = 6e-04
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = +3

Query: 360 VKADQCDRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKLIRKNTLFTDPGKK 533
           ++ D CDRLWV     L D    P  + P ++   L  +     L+R+ T+  D  K+
Sbjct: 153 IQVDVCDRLWVL-DTGLADILGSPKQITPNSI---LVFDLKTDTLLRRFTIPADQTKE 206


>AY071114-1|AAL48736.1|  358|Drosophila melanogaster RE16722p
           protein.
          Length = 358

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW++G+PA
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPA 111

Query: 238 TLNYIPW 258
           +L  +P+
Sbjct: 112 SLGTLPF 118



 Score = 31.9 bits (69), Expect = 0.70
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 9/95 (9%)
 Frame = +3

Query: 264 PYEPSPKLTPYPSFE--GNELGK-LSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTL-- 428
           P E SP + PYP++E  GN      SK   +  T V  D+CDR+W+     +  T  L  
Sbjct: 120 PKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAV--DRCDRIWLIDSGIVNATINLNQ 177

Query: 429 --PNGVAPYTLKC--FLTLNNLNSKLIRKNTLFTD 521
             P  +  Y LK    +   NL +  +++++L ++
Sbjct: 178 ICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSN 212


>AE014135-44|AAF59358.2|  463|Drosophila melanogaster CG1629-PA
           protein.
          Length = 463

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW++G+PA
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPA 111

Query: 238 TLNYIPW 258
           +L  +P+
Sbjct: 112 SLGTLPF 118



 Score = 31.9 bits (69), Expect = 0.70
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 9/95 (9%)
 Frame = +3

Query: 264 PYEPSPKLTPYPSFE--GNELGK-LSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTL-- 428
           P E SP + PYP++E  GN      SK   +  T V  D+CDR+W+     +  T  L  
Sbjct: 120 PKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAV--DRCDRIWLIDSGIVNATINLNQ 177

Query: 429 --PNGVAPYTLKC--FLTLNNLNSKLIRKNTLFTD 521
             P  +  Y LK    +   NL +  +++++L ++
Sbjct: 178 ICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSN 212


>AY118575-1|AAM49944.1|  453|Drosophila melanogaster LD43175p
           protein.
          Length = 453

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 222
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75

Query: 223 SGIPATLNYI 252
            G+PA+L Y+
Sbjct: 76  DGVPASLAYL 85



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWV 392
           P L P+PS++ + L + ++ + +    V+AD+C RLWV
Sbjct: 95  PALKPFPSWQAHNLQE-AEPELVSPFRVRADRCGRLWV 131


>AF237613-1|AAF60328.1|  453|Drosophila melanogaster YELLOW-B
           protein.
          Length = 453

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 222
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75

Query: 223 SGIPATLNYI 252
            G+PA+L Y+
Sbjct: 76  DGVPASLAYL 85



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWV 392
           P L P+PS++ + L + ++ + +    V+AD+C RLWV
Sbjct: 95  PALKPFPSWQAHNLQE-AEPELVSPFRVRADRCGRLWV 131


>AE014134-2765|AAF53564.1|  453|Drosophila melanogaster CG17914-PA
           protein.
          Length = 453

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 222
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75

Query: 223 SGIPATLNYI 252
            G+PA+L Y+
Sbjct: 76  DGVPASLAYL 85



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWV 392
           P L P+PS++ + L + ++ + +    V+AD+C RLWV
Sbjct: 95  PALKPFPSWQAHNLQE-AEPELVSPFRVRADRCGRLWV 131


>BT003613-1|AAO39616.1|  447|Drosophila melanogaster GH16592p
           protein.
          Length = 447

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/39 (51%), Positives = 29/39 (74%)
 Frame = +1

Query: 136 TGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           +G+ I  N +P G+  +R +LFV+VPR + GIP+TLNYI
Sbjct: 88  SGSFIQYNNVPQGVTHFRGRLFVTVPRRQPGIPSTLNYI 126


>AE014297-1605|AAF54884.1|  429|Drosophila melanogaster CG18550-PA
           protein.
          Length = 429

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/39 (51%), Positives = 29/39 (74%)
 Frame = +1

Query: 136 TGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           +G+ I  N +P G+  +R +LFV+VPR + GIP+TLNYI
Sbjct: 70  SGSFIQYNNVPQGVTHFRGRLFVTVPRRQPGIPSTLNYI 108


>AY060728-1|AAL28276.1|  452|Drosophila melanogaster GH17451p
           protein.
          Length = 452

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/35 (57%), Positives = 27/35 (77%)
 Frame = +1

Query: 148 IPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           IP N +P+G   +R +LFV++PR R GIP+TLNYI
Sbjct: 97  IPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYI 131



 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLW 389
           SPKL  YP+F  N+    ++    +Y     D C RLW
Sbjct: 141 SPKLRAYPNFALNQFNASAENLVSVYR-TSVDACQRLW 177


>AE014297-1606|AAF54885.2|  452|Drosophila melanogaster CG8063-PA
           protein.
          Length = 452

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/35 (57%), Positives = 27/35 (77%)
 Frame = +1

Query: 148 IPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           IP N +P+G   +R +LFV++PR R GIP+TLNYI
Sbjct: 97  IPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYI 131



 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLW 389
           SPKL  YP+F  N+    ++    +Y     D C RLW
Sbjct: 141 SPKLRAYPNFALNQFNASAENLVSVYR-TSVDACQRLW 177


>BT003303-1|AAO25063.1|  432|Drosophila melanogaster GH10609p
           protein.
          Length = 432

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE-----RWRNKLFVSVPRWRS 225
           ++ +  W  +++ +P    ++ A   G L+PEN  P+ ++       + +LF ++PR+ +
Sbjct: 34  VETLTQWGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVT 93

Query: 226 GIPATLNYIPWTLHMNHP 279
           GIP TL  +  T   N P
Sbjct: 94  GIPYTLATVSATQGRNGP 111


>AE013599-3589|AAF46992.2|  432|Drosophila melanogaster CG9889-PA
           protein.
          Length = 432

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE-----RWRNKLFVSVPRWRS 225
           ++ +  W  +++ +P    ++ A   G L+PEN  P+ ++       + +LF ++PR+ +
Sbjct: 34  VETLTQWGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVT 93

Query: 226 GIPATLNYIPWTLHMNHP 279
           GIP TL  +  T   N P
Sbjct: 94  GIPYTLATVSATQGRNGP 111


>AY121706-1|AAM52033.1|  412|Drosophila melanogaster RH49821p
           protein.
          Length = 412

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 6/77 (7%)
 Frame = +1

Query: 40  LASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRN------KLF 201
           LA++   L+ +F    ++  +P    +Q+ALR G   P + +P+ ++ +         +F
Sbjct: 15  LAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIF 74

Query: 202 VSVPRWRSGIPATLNYI 252
           V++PR+  G+P +L Y+
Sbjct: 75  VTIPRFAKGVPYSLAYV 91


>AE014297-1687|AAF54947.1|  426|Drosophila melanogaster CG17044-PA
           protein.
          Length = 426

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW------RNKLFVSVPRWRSGI 231
           +F W  + + +P +  + Q LR G   P++ +P+ I+ +        + FV+ PR+  G+
Sbjct: 35  VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGV 94

Query: 232 PATLNYI 252
           P +L Y+
Sbjct: 95  PFSLGYV 101


>AE013599-3590|AAF46993.1|  412|Drosophila melanogaster CG9891-PA
           protein.
          Length = 412

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 6/77 (7%)
 Frame = +1

Query: 40  LASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRN------KLF 201
           LA++   L+ +F    ++  +P    +Q+ALR G   P + +P+ ++ +         +F
Sbjct: 15  LAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIF 74

Query: 202 VSVPRWRSGIPATLNYI 252
           V++PR+  G+P +L Y+
Sbjct: 75  VTIPRFAKGVPYSLAYV 91


>AE014296-437|AAF47631.1|  393|Drosophila melanogaster CG5717-PA
           protein.
          Length = 393

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +1

Query: 97  NYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           ++P + +K   +++G  +P N +    +  R+  FV++PR++ G+P TL  +
Sbjct: 57  HWPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKV 108


>AE014296-438|AAF47632.1|  382|Drosophila melanogaster CG13804-PA
           protein.
          Length = 382

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 15/55 (27%), Positives = 30/55 (54%)
 Frame = +1

Query: 79  WNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATL 243
           W    + +P   +K     +G  IP+N +    +   + +++++PR+R G+PATL
Sbjct: 41  WTGGQFEFPCASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATL 95


>AY071489-1|AAL49111.1|  530|Drosophila melanogaster RE55542p
           protein.
          Length = 530

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           LQ    W ++ +N+  Q             P+N L  G+    +++FV+ P+  SG+P+T
Sbjct: 25  LQVAKQWKLLRYNFEPQAPVSDP---NFYNPQNVLITGLAVTDDRIFVATPKLFSGVPST 81

Query: 241 LNYI 252
           ++++
Sbjct: 82  VSWV 85


>AE014297-1688|AAF54948.1|  530|Drosophila melanogaster CG9792-PA
           protein.
          Length = 530

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           LQ    W ++ +N+  Q             P+N L  G+    +++FV+ P+  SG+P+T
Sbjct: 25  LQVAKQWKLLRYNFEPQAPVSDP---NFYNPQNVLITGLAVTDDRIFVATPKLFSGVPST 81

Query: 241 LNYI 252
           ++++
Sbjct: 82  VSWV 85


>U69607-1|AAD08845.1|  493|Drosophila melanogaster amylase-like
           protein protein.
          Length = 493

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -2

Query: 219 PPRNADEQFVPPPFDTNGQCV 157
           PPR+A E+ + P FD +G CV
Sbjct: 356 PPRDAQERIISPEFDADGACV 376


>AY052055-1|AAK93479.1|  493|Drosophila melanogaster LP08070p
           protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -2

Query: 219 PPRNADEQFVPPPFDTNGQCV 157
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


>AF022713-3|AAD09147.2|  493|Drosophila melanogaster putative
           amylase-related protein protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -2

Query: 219 PPRNADEQFVPPPFDTNGQCV 157
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


>AE013599-2321|AAF57971.1|  493|Drosophila melanogaster CG8221-PA
           protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -2

Query: 219 PPRNADEQFVPPPFDTNGQCV 157
           PP++A E+ + P FD +G CV
Sbjct: 356 PPQDAQERIISPEFDADGACV 376


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,221,099
Number of Sequences: 53049
Number of extensions: 641183
Number of successful extensions: 1687
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1681
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2482967880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).