SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81115-1|CAB03291.1|  365|Caenorhabditis elegans Hypothetical pr...   135   3e-32
D83738-1|BAA12091.1|  366|Caenorhabditis elegans aldolase Ce1 pr...   134   7e-32
U13070-15|AAC46646.1|  366|Caenorhabditis elegans Hypothetical p...   106   2e-23
U13070-14|AAM22057.1|  259|Caenorhabditis elegans Hypothetical p...   106   2e-23
D83739-1|BAA12092.1|  366|Caenorhabditis elegans aldolase Ce2 pr...   106   2e-23
Z82053-1|CAB04834.1|  233|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z49130-1|CAA88965.2|  708|Caenorhabditis elegans Hypothetical pr...    31   1.3  
AY551965-1|AAS65429.1| 2395|Caenorhabditis elegans Swi/Snf famil...    31   1.3  
AL132904-26|CAC35851.3| 2395|Caenorhabditis elegans Hypothetical...    31   1.3  
Z75542-4|CAA99861.1|  424|Caenorhabditis elegans Hypothetical pr...    29   4.0  
EF601082-1|ABQ96204.1|  370|Caenorhabditis elegans UNC-55a isofo...    29   4.0  
AC024775-8|AAK68458.1|  347|Caenorhabditis elegans Hypothetical ...    28   7.1  
Z81137-3|CAB03471.1|  338|Caenorhabditis elegans Hypothetical pr...    28   9.3  
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    28   9.3  

>Z81115-1|CAB03291.1|  365|Caenorhabditis elegans Hypothetical
           protein T05D4.1 protein.
          Length = 365

 Score =  135 bits (327), Expect = 3e-32
 Identities = 64/106 (60%), Positives = 78/106 (73%)
 Frame = +2

Query: 260 AVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQG 439
           A L++ ISGVI+FHET YQK DDG P  +LL+++GIIPGIKVDKGVVP+ G+  E TTQG
Sbjct: 68  ADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQG 127

Query: 440 LDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           LDDL  RCAQYKKDG  FAKWRC  + ++T P     ++    LAR
Sbjct: 128 LDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLAR 173



 Score = 92.3 bits (219), Expect = 4e-19
 Identities = 43/65 (66%), Positives = 53/65 (81%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M++Y Q+ T   ++EL+ IA AIV P KGILAADESTG+M KRL  IG+ENTEENRR+YR
Sbjct: 1   MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYR 60

Query: 240 QLLFS 254
           QLLF+
Sbjct: 61  QLLFT 65


>D83738-1|BAA12091.1|  366|Caenorhabditis elegans aldolase Ce1
           protein.
          Length = 366

 Score =  134 bits (324), Expect = 7e-32
 Identities = 64/125 (51%), Positives = 84/125 (67%)
 Frame = +2

Query: 260 AVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQG 439
           A L++ ISGVI+FHET YQK DDG P  +LL+++GIIPGIKVDKGVVP+ G+  E TTQG
Sbjct: 68  ADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQG 127

Query: 440 LDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRL 619
           LDDL  RCAQYKKDG  FAKWRC  + ++T P     ++    L      + +      +
Sbjct: 128 LDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLGSRYASICQQNGLVPI 187

Query: 620 LKPEV 634
           ++PE+
Sbjct: 188 VEPEI 192



 Score = 92.3 bits (219), Expect = 4e-19
 Identities = 43/65 (66%), Positives = 53/65 (81%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M++Y Q+ T   ++EL+ IA AIV P KGILAADESTG+M KRL  IG+ENTEENRR+YR
Sbjct: 1   MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYR 60

Query: 240 QLLFS 254
           QLLF+
Sbjct: 61  QLLFT 65


>U13070-15|AAC46646.1|  366|Caenorhabditis elegans Hypothetical
           protein F01F1.12a protein.
          Length = 366

 Score =  106 bits (255), Expect = 2e-23
 Identities = 49/81 (60%), Positives = 60/81 (74%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L+++ISGVIL+ ET +Q  D G     LL K+GI+PGIK+D GVVPL G+  E TTQGLD
Sbjct: 73  LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLD 132

Query: 446 DLAQRCAQYKKDGCHFAKWRC 508
            LA+R A +KK GC FAKWRC
Sbjct: 133 KLAERAAAFKKGGCGFAKWRC 153



 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 35/57 (61%), Positives = 43/57 (75%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           T   ++EL +IA  IV   KGILAADESTGT+GKRL  I +EN E NR++YRQLLF+
Sbjct: 13  TQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT 69



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 LLKIGRNTPSYQAIQENANV-SRPLTLPSVRANAFVPIVEARSL 636
           +L IG +TPS+  + ENANV +R  ++   +AN  VPIVE   L
Sbjct: 154 VLNIGTHTPSHLGMLENANVLARYASI--CQANGLVPIVEPEVL 195


>U13070-14|AAM22057.1|  259|Caenorhabditis elegans Hypothetical
           protein F01F1.12b protein.
          Length = 259

 Score =  106 bits (255), Expect = 2e-23
 Identities = 49/81 (60%), Positives = 60/81 (74%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L+++ISGVIL+ ET +Q  D G     LL K+GI+PGIK+D GVVPL G+  E TTQGLD
Sbjct: 73  LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLD 132

Query: 446 DLAQRCAQYKKDGCHFAKWRC 508
            LA+R A +KK GC FAKWRC
Sbjct: 133 KLAERAAAFKKGGCGFAKWRC 153



 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 35/57 (61%), Positives = 43/57 (75%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           T   ++EL +IA  IV   KGILAADESTGT+GKRL  I +EN E NR++YRQLLF+
Sbjct: 13  TQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT 69



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 LLKIGRNTPSYQAIQENANV-SRPLTLPSVRANAFVPIVEARSL 636
           +L IG +TPS+  + ENANV +R  ++   +AN  VPIVE   L
Sbjct: 154 VLNIGTHTPSHLGMLENANVLARYASI--CQANGLVPIVEPEVL 195


>D83739-1|BAA12092.1|  366|Caenorhabditis elegans aldolase Ce2
           protein.
          Length = 366

 Score =  106 bits (255), Expect = 2e-23
 Identities = 49/81 (60%), Positives = 60/81 (74%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L+++ISGVIL+ ET +Q  D G     LL K+GI+PGIK+D GVVPL G+  E TTQGLD
Sbjct: 73  LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLD 132

Query: 446 DLAQRCAQYKKDGCHFAKWRC 508
            LA+R A +KK GC FAKWRC
Sbjct: 133 KLAERAAAFKKGGCGFAKWRC 153



 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 35/57 (61%), Positives = 43/57 (75%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           T   ++EL +IA  IV   KGILAADESTGT+GKRL  I +EN E NR++YRQLLF+
Sbjct: 13  TQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT 69



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 LLKIGRNTPSYQAIQENANV-SRPLTLPSVRANAFVPIVEARSL 636
           +L IG +TPS+  + ENANV +R  ++   +AN  VPIVE   L
Sbjct: 154 VLNIGTHTPSHLGMLENANVLARYASI--CQANGLVPIVEPEVL 195


>Z82053-1|CAB04834.1|  233|Caenorhabditis elegans Hypothetical
           protein T26E3.1 protein.
          Length = 233

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = -1

Query: 524 RPIFSSNATWRSGSRPSCTGRSAGR---GRPDPGWCIRL 417
           RP  + N     G RP+  G  AG     RP+ GWC+R+
Sbjct: 42  RPPGNGNGNGNGGGRPTNGGCDAGWRRFNRPNGGWCVRV 80


>Z49130-1|CAA88965.2|  708|Caenorhabditis elegans Hypothetical
           protein T06D8.2 protein.
          Length = 708

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 744 VFTSEGEIP*SPKLVKRPGKFFQKKGL 824
           +F    E+P  PKL +  G+FFQKK L
Sbjct: 265 LFPENSELPSKPKLYQPVGEFFQKKSL 291


>AY551965-1|AAS65429.1| 2395|Caenorhabditis elegans Swi/Snf family
            ATPase protein.
          Length = 2395

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%)
 Frame = +1

Query: 427  HHPGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQA---IQENANVSRPLTLPSVR 597
            +HP    PRP + P    +L L   A L +I +  PS  +   I E  N+S+     SVR
Sbjct: 842  NHPNLFEPRPVVAPFVVEKLQLDVPARLFEISQQDPSSSSASQIPEIFNLSKIGYQSSVR 901

Query: 598  -ANAFVPIVEARSLY 639
             A   +  +EA S Y
Sbjct: 902  SAKPLIEELEAMSTY 916


>AL132904-26|CAC35851.3| 2395|Caenorhabditis elegans Hypothetical
            protein Y111B2A.22 protein.
          Length = 2395

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%)
 Frame = +1

Query: 427  HHPGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQA---IQENANVSRPLTLPSVR 597
            +HP    PRP + P    +L L   A L +I +  PS  +   I E  N+S+     SVR
Sbjct: 842  NHPNLFEPRPVVAPFVVEKLQLDVPARLFEISQQDPSSSSASQIPEIFNLSKIGYQSSVR 901

Query: 598  -ANAFVPIVEARSLY 639
             A   +  +EA S Y
Sbjct: 902  SAKPLIEELEAMSTY 916


>Z75542-4|CAA99861.1|  424|Caenorhabditis elegans Hypothetical
           protein F55D12.4 protein.
          Length = 424

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%)
 Frame = +1

Query: 388 QGCR--PAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALL--LKIGRNTPSYQAIQE 555
           Q CR    +R+G R     S   + A+  VQ GRLP+   +L       R+   + ++  
Sbjct: 107 QYCRLTKCIRMGMRKEGRRSNETQTAVSAVQRGRLPVTMPSLFPPNMFLRSPFPFMSVPF 166

Query: 556 NANVSRPLTLPSVRANAF 609
           N  ++   T PS++ + F
Sbjct: 167 NPLMTAQFTKPSIKESIF 184


>EF601082-1|ABQ96204.1|  370|Caenorhabditis elegans UNC-55a isoform
           protein.
          Length = 370

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%)
 Frame = +1

Query: 388 QGCR--PAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALL--LKIGRNTPSYQAIQE 555
           Q CR    +R+G R     S   + A+  VQ GRLP+   +L       R+   + ++  
Sbjct: 74  QYCRLTKCIRMGMRKEGRRSNETQTAVSAVQRGRLPVTMPSLFPPNMFLRSPFPFMSVPF 133

Query: 556 NANVSRPLTLPSVRANAF 609
           N  ++   T PS++ + F
Sbjct: 134 NPLMTAQFTKPSIKESIF 151


>AC024775-8|AAK68458.1|  347|Caenorhabditis elegans Hypothetical
           protein Y41D4A.8 protein.
          Length = 347

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +2

Query: 326 DGTPLVSLLEKKGII--PGIKVDKGVVPLFGSEDECT 430
           D +PLVS+L   G+I  P + +    VPLF  ED CT
Sbjct: 10  DPSPLVSVL---GLIKSPDLMIGSTEVPLFEEEDMCT 43


>Z81137-3|CAB03471.1|  338|Caenorhabditis elegans Hypothetical
           protein W02D9.4 protein.
          Length = 338

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
 Frame = +1

Query: 418 RRMHHPGSGRPRPALRPVQEGRLPLRQVALL----LKIGRNT--PSYQAIQENANVS 570
           RR HH G+ +  PA R +Q+G    R V  +    LK G+ +  P ++ +++N + S
Sbjct: 124 RRTHHHGTIKEYPAYRCIQKGCQTFRSVKKVLETDLKRGKLSILPEFEFLEQNESES 180


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -3

Query: 480 SFLYWAQRWARSSRPWVVHSSSDPNSGTTPLSTLMPGMMPFFSSRETRGVPSSA 319
           S L  +Q    +S P VV SSS  +S T   ST+ P      +S   +  PS++
Sbjct: 450 STLTLSQSPTPTSTPLVVSSSSSGSSSTVVTSTITPSTQGVPTSTSNQPTPSTS 503


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,437,585
Number of Sequences: 27780
Number of extensions: 484595
Number of successful extensions: 1393
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1283
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1393
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2040452812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).