SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC025726-12|AAK73914.3|  243|Caenorhabditis elegans Ubiquitin co...    71   7e-13
Z22179-13|CAA80166.1|  164|Caenorhabditis elegans Hypothetical p...    46   2e-05
AL110500-10|CAB60431.1|  170|Caenorhabditis elegans Hypothetical...    46   2e-05
AC024748-1|AAF60411.2|  218|Caenorhabditis elegans Ubiquitin con...    45   6e-05
U08139-1|AAA83388.1|  192|Caenorhabditis elegans ubc-1 protein.        40   0.002
AF045638-8|AAC02561.2|  192|Caenorhabditis elegans Ubiquitin con...    40   0.002
AC024747-1|AAO21404.1|  203|Caenorhabditis elegans Ubiquitin con...    35   0.078
Z68337-1|CAA92745.1|  147|Caenorhabditis elegans Hypothetical pr...    34   0.10 
S56051-1|AAB25489.2|  147|Caenorhabditis elegans ubiquitin-conju...    34   0.10 
AF040645-12|AAB94978.2|   78|Caenorhabditis elegans Hypothetical...    33   0.32 
U00035-7|AAA50648.2|  153|Caenorhabditis elegans Ubiquitin conju...    30   1.7  
AF039711-8|ABS19466.1|  766|Caenorhabditis elegans Hypothetical ...    30   1.7  
AL021175-5|CAA15967.1|  357|Caenorhabditis elegans Hypothetical ...    29   2.9  
U97405-7|AAB53006.1|  125|Caenorhabditis elegans Hypothetical pr...    29   3.9  
AL032653-6|CAA21716.1|  152|Caenorhabditis elegans Hypothetical ...    29   3.9  
AF099919-11|AAC68796.1|  199|Caenorhabditis elegans Ubiquitin co...    29   3.9  
AC024761-6|AAF59467.3|  599|Caenorhabditis elegans Hypothetical ...    29   5.1  
AC024761-5|AAU05550.1|  601|Caenorhabditis elegans Hypothetical ...    29   5.1  
Z81108-2|CAB03238.1|  180|Caenorhabditis elegans Hypothetical pr...    28   6.8  
U23517-9|AAB93334.2|  314|Caenorhabditis elegans Ubiquitin conju...    28   6.8  
AL032627-8|CAB63354.2|  373|Caenorhabditis elegans Hypothetical ...    28   6.8  
U70849-3|AAK67232.1|  166|Caenorhabditis elegans Ubiquitin conju...    28   9.0  
U00048-3|AAB53827.3|  315|Caenorhabditis elegans Nematode astaci...    28   9.0  
AF106565-1|AAC97374.1|  166|Caenorhabditis elegans ubiquitin-con...    28   9.0  
AF036687-2|AAB88311.2| 2224|Caenorhabditis elegans Hypothetical ...    28   9.0  

>AC025726-12|AAK73914.3|  243|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein3 protein.
          Length = 243

 Score = 71.3 bits (167), Expect = 7e-13
 Identities = 44/117 (37%), Positives = 57/117 (48%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRH 526
           S    +S ALRAL +E K+LQ +PVEGF + +  EDNLF W V I+GPP TLYQ    + 
Sbjct: 3   SKASTSSGALRALTMELKNLQSQPVEGFTIDV-NEDNLFVWTVGIYGPPKTLYQGGYFKA 61

Query: 527 T*NSPLTTRIHHHPLGFLTKVWASKCI*KRRSLHIDSPPARGMILSLANCPCERWEP 697
           +   P         + F TKVW    + +   L I    +           CERW P
Sbjct: 62  SIRFPSNYPYSPPSMKFTTKVWHPN-VYENGDLCISILHSPIDDPQSGELACERWNP 117



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 27/46 (58%), Positives = 28/46 (60%)
 Frame = +3

Query: 576 F*LKSGHPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVR 713
           F  K  HPNVYENGDLCISILH P+        A     NPTQSVR
Sbjct: 78  FTTKVWHPNVYENGDLCISILHSPIDDPQSGELA-CERWNPTQSVR 122



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 24/55 (43%), Positives = 32/55 (58%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           GYFKA ++FP +YPYSPPS++         +Y   ++        P DDPQSGEL
Sbjct: 57  GYFKASIRFPSNYPYSPPSMKFTTKVWHPNVYENGDL-CISILHSPIDDPQSGEL 110


>Z22179-13|CAA80166.1|  164|Caenorhabditis elegans Hypothetical
           protein F58A4.10 protein.
          Length = 164

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 19/70 (27%), Positives = 39/70 (55%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   ++  PV+GF   L+ ++++++WEV + GPPDTLY+    +   + P       
Sbjct: 8   LKKQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKP 67

Query: 563 HPLGFLTKVW 592
             + F++++W
Sbjct: 68  PKMKFISEIW 77



 Score = 31.9 bits (69), Expect = 0.55
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ + G++CISILH P
Sbjct: 78  HPNIDKEGNVCISILHDP 95


>AL110500-10|CAB60431.1|  170|Caenorhabditis elegans Hypothetical
           protein Y87G2A.9 protein.
          Length = 170

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/45 (46%), Positives = 25/45 (55%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           AL+ L  EYK L   P EG     + EDN FEWE  I GP +T +
Sbjct: 5   ALKRLMTEYKELTTRPPEGIIAAPIDEDNFFEWECLITGPEETCF 49



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+Y +G +CISILH P
Sbjct: 79  HPNIYADGRVCISILHAP 96



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 19/57 (33%), Positives = 25/57 (43%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           ++G F A + FP DYP SPP +R         +Y    +        P DDP   EL
Sbjct: 50  ANGVFPARITFPQDYPLSPPKMRFTCGIFHPNIYADGRV-CISILHAPGDDPTGYEL 105


>AC024748-1|AAF60411.2|  218|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein15 protein.
          Length = 218

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           +SSA+R L  +Y  L ++PV+G +  L  EDN+ EW   + G PDT
Sbjct: 17  SSSAVRRLQKDYAKLMQDPVDGIKA-LPNEDNILEWHYCLRGSPDT 61


>U08139-1|AAA83388.1|  192|Caenorhabditis elegans ubc-1 protein.
          Length = 192

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           T+ + R L  ++K LQE+P  G       EDN+  WE  IFGP +T ++  T
Sbjct: 2   TTPSRRRLMRDFKKLQEDPPAGVSGAPT-EDNILTWEAIIFGPQETPFEDGT 52



 Score = 28.3 bits (60), Expect = 6.8
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +3

Query: 585 KSGHPNVYENGDLCISIL 638
           K  HPNVY +G +C+ IL
Sbjct: 75  KMFHPNVYADGSICLDIL 92


>AF045638-8|AAC02561.2|  192|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein1 protein.
          Length = 192

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           T+ + R L  ++K LQE+P  G       EDN+  WE  IFGP +T ++  T
Sbjct: 2   TTPSRRRLMRDFKKLQEDPPAGVSGAPT-EDNILTWEAIIFGPQETPFEDGT 52



 Score = 28.3 bits (60), Expect = 6.8
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +3

Query: 585 KSGHPNVYENGDLCISIL 638
           K  HPNVY +G +C+ IL
Sbjct: 75  KMFHPNVYADGSICLDIL 92


>AC024747-1|AAO21404.1|  203|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein26 protein.
          Length = 203

 Score = 34.7 bits (76), Expect = 0.078
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           AL+ L  +Y+ L +EPV   +   L E N+ EW   I G P T Y+
Sbjct: 9   ALQRLKKDYQRLLKEPVPFMKAAPL-ETNILEWRYIIIGAPKTPYE 53


>Z68337-1|CAA92745.1|  147|Caenorhabditis elegans Hypothetical
           protein M7.1 protein.
          Length = 147

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 20/74 (27%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + L  +P        +G+D LF W+  I GPP++ YQ      T + P   
Sbjct: 2   ALKRIQKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPESPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>S56051-1|AAB25489.2|  147|Caenorhabditis elegans
           ubiquitin-conjugating enzyme protein.
          Length = 147

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 20/74 (27%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + L  +P        +G+D LF W+  I GPP++ YQ      T + P   
Sbjct: 2   ALKRIQKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPESPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AF040645-12|AAB94978.2|   78|Caenorhabditis elegans Hypothetical
           protein F52C6.12 protein.
          Length = 78

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 20/67 (29%), Positives = 30/67 (44%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D L+ W+  I GPP++ YQ      T  S  T 
Sbjct: 2   ALKRIQKELHDLGRDPPAQCSTGSVGDD-LYHWQATIMGPPESPYQGGIFFLTITSRQTI 60

Query: 551 RIHHHPL 571
             +H  L
Sbjct: 61  HSNHQRL 67


>U00035-7|AAA50648.2|  153|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein18 protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G FK  + FP DYP+ PP +
Sbjct: 47  NKGAFKVGITFPVDYPFKPPKV 68


>AF039711-8|ABS19466.1|  766|Caenorhabditis elegans Hypothetical
           protein F49D11.10 protein.
          Length = 766

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -3

Query: 480 IATSHSNRLSSPSNLTRKPSTGSSCRLLYSNAKALRAELV 361
           +   +SN + SP+N     +TG+SC +L+S+ K   A  V
Sbjct: 12  VGQPYSNLVISPNNRILATTTGASCEVLFSDKKGNDARRV 51


>AL021175-5|CAA15967.1|  357|Caenorhabditis elegans Hypothetical
           protein Y6E2A.6 protein.
          Length = 357

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 699 TQSVRNRYSPSGNLNPSKEPEHLSVPGERSM 791
           T +VRN + P  N N  K+PE+  + G+ S+
Sbjct: 326 TGTVRNSWKPQTNGNSQKQPENYQMAGQTSV 356


>U97405-7|AAB53006.1|  125|Caenorhabditis elegans Hypothetical
           protein T09B4.3 protein.
          Length = 125

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -2

Query: 790 IDRSPGTERCSGSFEGLRLPEGEYRLRTDC-VGFPTFAGAVRQTED 656
           IDRS   ++   S+E L   E E R +  C +GF T A A  +T +
Sbjct: 32  IDRSESLDQLKESYESLMKSENEKRKKDGCFIGFLTKALAEEETTE 77


>AL032653-6|CAA21716.1|  152|Caenorhabditis elegans Hypothetical
           protein Y54E5B.4 protein.
          Length = 152

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +3

Query: 594 HPNVYENGDLCISIL 638
           HP++Y NG +C+SIL
Sbjct: 82  HPHIYSNGHICLSIL 96



 Score = 28.7 bits (61), Expect = 5.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDN-LFEWEVAIFGPPDTLY 505
           + +A R L  E   L+ E  EG  V      N L +W++ + G   TLY
Sbjct: 2   SDAATRRLMKELAQLKSEAPEGLLVDNTSTSNDLKQWKIGVVGAEGTLY 50


>AF099919-11|AAC68796.1|  199|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein20 protein.
          Length = 199

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSIR 573
           + G F   +K P  YP+SPP+++
Sbjct: 52  AGGMFDLDIKIPDQYPFSPPNVK 74


>AC024761-6|AAF59467.3|  599|Caenorhabditis elegans Hypothetical
           protein Y38C1AA.5a protein.
          Length = 599

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 595 IQMYMKTEIFAYRFSTRPWDDPQSGEL--PLRTLGTLHNRFATGTPPLV--ISIPQRSP 759
           +  Y    IFA    T P  DP  G +  P+ T+G  H       PPL   I +PQRSP
Sbjct: 203 VSTYPMAPIFAETIPTSPAKDPSEGYVTRPISTVG--H----PSPPPLFPNIPVPQRSP 255


>AC024761-5|AAU05550.1|  601|Caenorhabditis elegans Hypothetical
           protein Y38C1AA.5b protein.
          Length = 601

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 595 IQMYMKTEIFAYRFSTRPWDDPQSGEL--PLRTLGTLHNRFATGTPPLV--ISIPQRSP 759
           +  Y    IFA    T P  DP  G +  P+ T+G  H       PPL   I +PQRSP
Sbjct: 205 VSTYPMAPIFAETIPTSPAKDPSEGYVTRPISTVG--H----PSPPPLFPNIPVPQRSP 257


>Z81108-2|CAB03238.1|  180|Caenorhabditis elegans Hypothetical
           protein R09B3.4 protein.
          Length = 180

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +3

Query: 585 KSGHPNVYENGDLCISIL 638
           K  HPN+ E+G +C+SIL
Sbjct: 99  KVWHPNINEDGSICLSIL 116


>U23517-9|AAB93334.2|  314|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein6 protein.
          Length = 314

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = +1

Query: 487 TAGYTLSSGYFKAHMKFPPDYPYSPPSI 570
           T G     G +   + FP DYP  PP++
Sbjct: 48  TLGTDFEGGIYHGRIIFPADYPMKPPNL 75



 Score = 27.9 bits (59), Expect = 9.0
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +2

Query: 344 MSNTVPTSSA-LRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           MS    T +A +R L  E   L++ P E +  + + EDNLFEW   I G   T ++
Sbjct: 1   MSEQYNTKNAGVRRLMKEAMELRQ-PTEMYHAQPM-EDNLFEWHFTIRGTLGTDFE 54


>AL032627-8|CAB63354.2|  373|Caenorhabditis elegans Hypothetical
           protein Y41C4A.5 protein.
          Length = 373

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPP 564
           GY+     +PP YPY PP
Sbjct: 297 GYYPPGYPYPPGYPYPPP 314


>U70849-3|AAK67232.1|  166|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein9 protein.
          Length = 166

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +3

Query: 594 HPNVYENGDLCISIL 638
           HPNVY +G +C+S+L
Sbjct: 83  HPNVYPSGTVCLSLL 97


>U00048-3|AAB53827.3|  315|Caenorhabditis elegans Nematode astacin
           protease protein 4 protein.
          Length = 315

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -2

Query: 250 PGISTRHNNNELEILVNIASILQHPQV 170
           PG+S  +NNN     +N  SI+ HPQV
Sbjct: 290 PGVSGNNNNNNNN-QINSNSIVNHPQV 315


>AF106565-1|AAC97374.1|  166|Caenorhabditis elegans
           ubiquitin-conjugating enzyme 9homolog protein.
          Length = 166

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +3

Query: 594 HPNVYENGDLCISIL 638
           HPNVY +G +C+S+L
Sbjct: 83  HPNVYPSGTVCLSLL 97


>AF036687-2|AAB88311.2| 2224|Caenorhabditis elegans Hypothetical
            protein C08G9.2 protein.
          Length = 2224

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +2

Query: 596  SKCI*KRRSLHIDSPPARGMILSLANCPCERW 691
            S+CI K    H++ P A+  IL  A+CP  +W
Sbjct: 1797 SECICKSACEHVECPNAQVCILRKADCP-NKW 1827


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,762,579
Number of Sequences: 27780
Number of extensions: 493125
Number of successful extensions: 1298
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1228
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1292
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1966828226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).