SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical...   111   5e-25
AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical ...   111   5e-25
Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein ( C.ele...   103   1e-22
U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation fact...   103   1e-22
U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical p...    76   2e-14
AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved ger...    58   6e-09
AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical ...    53   2e-07
AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical ...    53   2e-07
Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical pr...    50   2e-06
Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical pr...    50   2e-06
U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA he...    50   2e-06
Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical pr...    46   3e-05
Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical pr...    46   3e-05
Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr...    46   3e-05
EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.     46   3e-05
CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical ...    46   3e-05
AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical...    45   6e-05
AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical ...    45   6e-05
AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical ...    45   6e-05
AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical...    44   8e-05
Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical pr...    43   3e-04
AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical ...    42   3e-04
U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase pr...    42   6e-04
L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase pr...    42   6e-04
AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical ...    42   6e-04
AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical ...    42   6e-04
AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line hel...    42   6e-04
U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.        41   0.001
U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GL...    41   0.001
AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line he...    41   0.001
Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical pr...    40   0.002
AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA ...    39   0.004
AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA ...    39   0.004
AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line hel...    39   0.004
AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line hel...    39   0.004
U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical pr...    38   0.006
Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical pr...    38   0.010
AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical ...    38   0.010
AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and bel...    37   0.013
AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and bel...    37   0.013
AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and bel...    37   0.013
Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical pr...    36   0.022
Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical pr...    35   0.052
AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical ...    35   0.052
AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical...    33   0.27 
U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical pr...    32   0.36 
U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical pr...    32   0.36 
AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical ...    32   0.36 
AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical ...    31   1.1  
AC006696-10|AAF39990.1|  228|Caenorhabditis elegans Hypothetical...    29   3.4  
Z34989-1|CAA84441.1|  404|Caenorhabditis elegans Ndr protein kin...    29   4.5  
U41016-7|ABC71807.1|  476|Caenorhabditis elegans Sensory axon gu...    29   4.5  
U41016-6|ABC71808.1|  474|Caenorhabditis elegans Sensory axon gu...    29   4.5  
AF275634-1|AAF91417.1|  469|Caenorhabditis elegans SAX-1 Ndr pro...    29   4.5  
Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical pr...    28   5.9  
Z50109-6|CAA90439.2|  344|Caenorhabditis elegans Hypothetical pr...    28   5.9  
U21308-11|AAB93312.3|  265|Caenorhabditis elegans Roller: helica...    28   5.9  
U21308-10|AAN65281.1|  329|Caenorhabditis elegans Roller: helica...    28   5.9  
M25477-1|AAA27991.1|  329|Caenorhabditis elegans collagen protein.     28   5.9  
AC084197-31|AAG23466.1|  105|Caenorhabditis elegans Hypothetical...    28   5.9  
AC084155-1|AAG23361.2|  352|Caenorhabditis elegans Hypothetical ...    28   7.8  

>AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical
           protein F33D11.10 protein.
          Length = 399

 Score =  111 bits (267), Expect = 5e-25
 Identities = 50/67 (74%), Positives = 61/67 (91%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +DT +RE QALIL+PTRELA QIQKVV+ALGD++N +CHACIGGTN+ 
Sbjct: 76  KTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLG 135

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 136 EDIRKLD 142



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 40/53 (75%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V+ TFD M L+E+LLRGIYAYGFEKPSAIQQRA+   ++ RDVIAQAQSGTGK
Sbjct: 24  VIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGK 76



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 16/27 (59%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IKL VLDEADE
Sbjct: 153 GRVFDMIRRRNLRTRAIKLLVLDEADE 179


>AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical
           protein Y65B4A.6 protein.
          Length = 399

 Score =  111 bits (267), Expect = 5e-25
 Identities = 50/67 (74%), Positives = 61/67 (91%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +DT +RE QALIL+PTRELA QIQKVV+ALGD++N +CHACIGGTN+ 
Sbjct: 76  KTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLG 135

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 136 EDIRKLD 142



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 40/53 (75%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   ++ RDVIAQAQSGTGK
Sbjct: 24  IIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGK 76



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 16/27 (59%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IKL VLDEADE
Sbjct: 153 GRVFDMIRRRNLRTRAIKLLVLDEADE 179


>Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein (
           C.elegans mRNA for eIF-4A homologue. ).
          Length = 402

 Score =  103 bits (247), Expect = 1e-22
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G +  ++DQVVE+FDDM LKEELLRGIY +GFEKPSAIQ+RAI+PC  G+DVIAQAQSGT
Sbjct: 18  GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGT 77

Query: 252 GK 257
           GK
Sbjct: 78  GK 79



 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 44/67 (65%), Positives = 54/67 (80%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFS+SILQ+ID      QAL++APTRELAQQIQKV+ ALG++LN     CIGGT+VR
Sbjct: 79  KTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVR 138

Query: 434 EDIRQLE 454
           +D R+LE
Sbjct: 139 DDQRKLE 145



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 16/27 (59%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI       + IK+FVLDEADE
Sbjct: 156 GRVGDMINRNALDTSRIKMFVLDEADE 182


>U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation factor
           protein 1, isoforma protein.
          Length = 402

 Score =  103 bits (247), Expect = 1e-22
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G +  ++DQVVE+FDDM LKEELLRGIY +GFEKPSAIQ+RAI+PC  G+DVIAQAQSGT
Sbjct: 18  GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGT 77

Query: 252 GK 257
           GK
Sbjct: 78  GK 79



 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 44/67 (65%), Positives = 54/67 (80%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFS+SILQ+ID      QAL++APTRELAQQIQKV+ ALG++LN     CIGGT+VR
Sbjct: 79  KTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVR 138

Query: 434 EDIRQLE 454
           +D R+LE
Sbjct: 139 DDQRKLE 145



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 16/27 (59%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI       + IK+FVLDEADE
Sbjct: 156 GRVGDMINRNALDTSRIKMFVLDEADE 182


>U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical
           protein F57B9.3 protein.
          Length = 363

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 33/51 (64%), Positives = 42/51 (82%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           M LKEELLRGIY +GFEKPSAIQ+ A+ PC  G+DV  Q+Q+G+GK ++SL
Sbjct: 1   MELKEELLRGIYGFGFEKPSAIQKSAVAPCTTGKDVTIQSQAGSGKTVISL 51



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 22/62 (35%), Positives = 32/62 (51%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT    I ILQ ID      Q ++LAP R +AQ+  + + +LG +LN     C+G     
Sbjct: 46  KTVISLIDILQGIDCEDAHLQVILLAPQRGMAQRAHEQLKSLGRNLNVNA-TCLGFDTTA 104

Query: 434 ED 439
           E+
Sbjct: 105 EN 106


>AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved
           germline helicase protein1 protein.
          Length = 430

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 23/66 (34%), Positives = 42/66 (63%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  + I ++++I  +++  QA+++ PTRELA Q  ++ + L  H+  K     GGT++R
Sbjct: 93  KTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDLR 152

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 153 DDIMRL 158



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 23/49 (46%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  L  +LL GI+  G+EKPS IQ+ +I   + G+D++A+A++GTGK
Sbjct: 45  FEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGK 93


>AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical
           protein H20J04.4a protein.
          Length = 488

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 28/66 (42%), Positives = 37/66 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++ 
Sbjct: 139 KTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLI 198

Query: 434 EDIRQL 451
              R+L
Sbjct: 199 HQAREL 204


>AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical
           protein H20J04.4b protein.
          Length = 561

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 28/66 (42%), Positives = 37/66 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++ 
Sbjct: 139 KTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLI 198

Query: 434 EDIRQL 451
              R+L
Sbjct: 199 HQAREL 204


>Z54327-7|CAD57690.1|  268|Caenorhabditis elegans Hypothetical
           protein C26D10.2b protein.
          Length = 268

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 25/49 (51%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK E+LR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 43  FRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAILGMDVVCQAKSGMGK 91



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  +
Sbjct: 91  KTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMAI 150

Query: 431 REDIRQL 451
           ++D  +L
Sbjct: 151 KKDEERL 157


>Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical
           protein C26D10.2a protein.
          Length = 425

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 25/49 (51%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK E+LR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 43  FRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAILGMDVVCQAKSGMGK 91



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  +
Sbjct: 91  KTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMAI 150

Query: 431 REDIRQL 451
           ++D  +L
Sbjct: 151 KKDEERL 157


>U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA
           helicase protein.
          Length = 417

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 25/49 (51%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK E+LR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 42  FRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAILGMDVVCQAKSGMGK 90



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F I+ LQQ++    E   + +  TRELA QI K       +L   K     GG  +
Sbjct: 90  KTAVFVITTLQQLEPVDGEVSVVCMCHTRELAFQISKEYERFSKYLPGVKVAVFFGGMAI 149

Query: 431 REDIRQL 451
           ++D  +L
Sbjct: 150 KKDEERL 156


>Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical
           protein T07D4.4c protein.
          Length = 613

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N+
Sbjct: 261 KTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGNM 320



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           + +F ++ LK E+L+ +    F+ P+ IQ+ A+   +     ++IAQAQSGTGK
Sbjct: 208 ISSFRELRLKPEVLKALDTMNFQFPTRIQETALPLLLMEPPSNLIAQAQSGTGK 261


>Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical
           protein T07D4.4b protein.
          Length = 638

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N+
Sbjct: 286 KTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGNM 345



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           + +F ++ LK E+L+ +    F+ P+ IQ+ A+   +     ++IAQAQSGTGK
Sbjct: 233 ISSFRELRLKPEVLKALDTMNFQFPTRIQETALPLLLMEPPSNLIAQAQSGTGK 286


>Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical
           protein T07D4.4a protein.
          Length = 1022

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N+
Sbjct: 670 KTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGNM 729



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           + +F ++ LK E+L+ +    F+ P+ IQ+ A+   +     ++IAQAQSGTGK
Sbjct: 617 ISSFRELRLKPEVLKALDTMNFQFPTRIQETALPLLLMEPPSNLIAQAQSGTGK 670


>EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.
          Length = 973

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           TF+ + + ++ L  +    F++PS +Q RAI   + GRD++ QA+SGTGK L+
Sbjct: 23  TFESLMIGQKTLERLKNSQFDRPSPVQARAIPVGLLGRDMLVQAKSGTGKTLV 75



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  FS+  ++ +D+     Q +I+ PTRE++ QI++ V  +     A+    +GG+
Sbjct: 72  KTLVFSVLAVENLDSRSSHIQKVIVTPTREISVQIKETVRKVAP-TGARTSVYVGGS 127


>CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical
           protein T06A10.1 protein.
          Length = 973

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           TF+ + + ++ L  +    F++PS +Q RAI   + GRD++ QA+SGTGK L+
Sbjct: 23  TFESLMIGQKTLERLKNSQFDRPSPVQARAIPVGLLGRDMLVQAKSGTGKTLV 75



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  FS+  ++ +D+     Q +I+ PTRE++ QI++ V  +     A+    +GG+
Sbjct: 72  KTLVFSVLAVENLDSRSSHIQKVIVTPTREISVQIKETVRKVAP-TGARTSVYVGGS 127


>AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical
           protein Y71G12B.8 protein.
          Length = 763

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F+ MNL  ++L+     G+  P+ IQQ  I   + G+D+ A A +GTGK
Sbjct: 149 SFEQMNLSRQILKACSGAGYSDPTPIQQACIPVALTGKDICACAATGTGK 198



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIR--EC-QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + IL+++    +   C + L+L PTRELA Q+ +V   L   +  +   C GG 
Sbjct: 198 KTAAFVLPILERMIYRPKGASCTRVLVLVPTRELAIQVFQVFRKLSTFIQLEVCLCAGGL 257

Query: 425 NVR 433
           +++
Sbjct: 258 DLK 260


>AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5a protein.
          Length = 825

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F I +LQ++        +AL+++PTRELA Q  KVV  LG     +C   +GG  +
Sbjct: 74  KTAAFVIPMLQKLKRRDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCACLVGGDQI 133

Query: 431 RE 436
            E
Sbjct: 134 EE 135



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ-GRDVIAQAQSGTGK 257
           +  + L   + + I   GF +P+ IQ++ I PCI  G+DV+A +++G+GK
Sbjct: 26  WQQIGLDHSVYKAIEKKGFNQPTPIQRKTI-PCIMDGKDVVAMSRTGSGK 74


>AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5b protein.
          Length = 871

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F I +LQ++        +AL+++PTRELA Q  KVV  LG     +C   +GG  +
Sbjct: 74  KTAAFVIPMLQKLKRRDTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCACLVGGDQI 133

Query: 431 RE 436
            E
Sbjct: 134 EE 135



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ-GRDVIAQAQSGTGK 257
           +  + L   + + I   GF +P+ IQ++ I PCI  G+DV+A +++G+GK
Sbjct: 26  WQQIGLDHSVYKAIEKKGFNQPTPIQRKTI-PCIMDGKDVVAMSRTGSGK 74


>AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.19 protein.
          Length = 643

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGKLL 263
           D  Q +  F D++L E +   I   G+++P+ +Q+ +I P +QG RD+++ AQ+G+GK  
Sbjct: 160 DVPQPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSI-PALQGGRDLMSCAQTGSGKTA 218

Query: 264 LSLYRFYNKSIQ 299
             L    N  +Q
Sbjct: 219 AFLVPLVNAILQ 230


>Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical
           protein T26G10.1 protein.
          Length = 489

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++F ++ + + L       G+ KPS IQQ A+   +QG+DVI  A++G+GK
Sbjct: 44  KSFAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGK 94



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  F+I +LQ +    +    L+L PTRELA QI +   ALG  +       +GG ++
Sbjct: 94  KTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDM 152


>AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical
           protein C24H12.4a protein.
          Length = 634

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/57 (29%), Positives = 36/57 (63%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D++   +TF D  L E +L+ I   G+EK + +Q+  I   ++ ++++ +A++G+GK
Sbjct: 83  DFEPEHKTFADFGLDERILKSIGELGWEKANQVQESVISLALENKNIMGRARTGSGK 139



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 7/53 (13%)
 Frame = +2

Query: 254 KTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHL 391
           KT  F I ++Q++       D S+    A+I+APT+EL  QI K+ + L   L
Sbjct: 139 KTGAFLIPLVQKLIAESKTNDGSVGP-SAVIIAPTKELITQIYKLFVKLSQAL 190


>U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ A+    QG D++A AQ+G+GK
Sbjct: 341 KTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTGSGK 391


>L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ A+    QG D++A AQ+G+GK
Sbjct: 341 KTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTGSGK 391


>AF067608-1|AAC17654.2|  544|Caenorhabditis elegans Hypothetical
           protein B0511.6 protein.
          Length = 544

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/45 (40%), Positives = 30/45 (66%)
 Frame = +3

Query: 138 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           LL+ +   GF   + IQ ++I P ++G+DV+A A++G+GK L  L
Sbjct: 79  LLKAVQGLGFTTMTEIQAKSIDPLLEGKDVLASAKTGSGKTLAFL 123


>AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical
           protein F53H1.1 protein.
          Length = 970

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 24/90 (26%), Positives = 48/90 (53%)
 Frame = +3

Query: 3   QRIPKMGHRRIKVVTMDLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSA 182
           + I +M    +K    +L   T+  +  D  + ++T+    +  +++  +  + + KP++
Sbjct: 272 EEIRRMTKAEVKAYREELDSITVKGI--DCPKPIKTWAQCGVNLKMMNVLKKFEYSKPTS 329

Query: 183 IQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           IQ +AI   + GRDVI  A++G+GK L  L
Sbjct: 330 IQAQAIPSIMSGRDVIGIAKTGSGKTLAFL 359



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 19/46 (41%), Positives = 22/46 (47%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+ILAPTRELA Q  K        L  K     GG  + E I  L+
Sbjct: 380 AVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQIADLK 425


>AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line
           helicase protein 1 protein.
          Length = 763

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ A+    QG D++A AQ+G+GK
Sbjct: 341 KTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTGSGK 391


>U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.
          Length = 974

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ  +    QG D++A AQ+G+GK
Sbjct: 552 KTFSEANLGETMKKNVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTGSGK 602


>U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GLH-2
           protein.
          Length = 974

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ  +    QG D++A AQ+G+GK
Sbjct: 552 KTFSEANLGETMKKNVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTGSGK 602


>AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line
           helicase protein 2 protein.
          Length = 974

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF + NL E + + +   G+ K + IQQ  +    QG D++A AQ+G+GK
Sbjct: 552 KTFSEANLGETMKKNVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTGSGK 602


>Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical
           protein ZK512.2 protein.
          Length = 578

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 3/76 (3%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSI---RECQALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           SP  + KT  F + +++ I  +     +  ALIL+P+REL  QI  V+    + LN    
Sbjct: 53  SPTGSGKTLAFVLPMMRMIQNAKLQPADIGALILSPSRELCSQIVSVIQPFAEKLNLTVE 112

Query: 407 ACIGGTNVREDIRQLE 454
              GG  V ++I+  +
Sbjct: 113 TVTGGQKVDKNIKMFK 128


>AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA
           helicase-3 protein.
          Length = 720

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           Q  ++F D ++ + + R +   G+ + + IQQ  +     G+D++A AQ+G+GK
Sbjct: 295 QPCKSFSDSDIPQSMRRNVERAGYTRTTPIQQYTLPLVADGKDILACAQTGSGK 348


>AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA
           helicase-4 protein.
          Length = 1156

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 108 TFDDMN-LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFY 284
           +FD    L ++L   +      +P+ IQ+ +  P + G DV+A A +G+GK L  L  F 
Sbjct: 736 SFDGFKILPQDLHDNLKRMKMNRPTPIQRASFFPIMHGNDVVACAHTGSGKTLAFLIPFV 795

Query: 285 NKSIQAF 305
            K ++ F
Sbjct: 796 IKLMEEF 802



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           LI+APTREL  Q       L      KC    GG +   +++ L
Sbjct: 818 LIVAPTRELVNQTFTTARQLTYETGLKCGLAFGGYSRNANVQHL 861


>AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line
           helicase protein 4 protein.
          Length = 1156

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 108 TFDDMN-LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFY 284
           +FD    L ++L   +      +P+ IQ+ +  P + G DV+A A +G+GK L  L  F 
Sbjct: 736 SFDGFKILPQDLHDNLKRMKMNRPTPIQRASFFPIMHGNDVVACAHTGSGKTLAFLIPFV 795

Query: 285 NKSIQAF 305
            K ++ F
Sbjct: 796 IKLMEEF 802



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           LI+APTREL  Q       L      KC    GG +   +++ L
Sbjct: 818 LIVAPTRELVNQTFTTARQLTYETGLKCGLAFGGYSRNANVQHL 861


>AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line
           helicase protein 3 protein.
          Length = 720

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           Q  ++F D ++ + + R +   G+ + + IQQ  +     G+D++A AQ+G+GK
Sbjct: 295 QPCKSFSDSDIPQSMRRNVERAGYTRTTPIQQYTLPLVADGKDILACAQTGSGK 348


>U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical
           protein F01F1.7 protein.
          Length = 730

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 16/52 (30%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +  +++    +E+ + +   G+ +P+ IQ++AI   +Q RDVI  A++G+GK
Sbjct: 300 LRNWEEAGFPDEVYQAVKEIGYLEPTPIQRQAIPIGLQNRDVIGVAETGSGK 351



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 21/41 (51%), Positives = 27/41 (65%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRED 439
           A+I+APTRELAQQI++     G  L  K  + IGG + RED
Sbjct: 381 AIIMAPTRELAQQIEEETNKFGKLLGIKTVSVIGGAS-RED 420


>Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical
           protein F58E10.3a protein.
          Length = 561

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/45 (44%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L PTRELAQQ+Q+V I     L  K     GG +     R LE
Sbjct: 206 LVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLE 250



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
 Frame = +3

Query: 159 YG-FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           YG F+KP+ IQ  +    + GRD+I+ A++G+GK L
Sbjct: 146 YGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTL 181


>AC024753-1|AAF60456.1|  732|Caenorhabditis elegans Hypothetical
           protein Y23H5B.6 protein.
          Length = 732

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F+D  L    L G+    + KP+ IQ+  I   + G DV+  A++G+GK L
Sbjct: 78  FEDFPLSWRTLEGLKDNDYTKPTEIQRDTIAYSLTGSDVVGAAKTGSGKTL 128



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/38 (47%), Positives = 24/38 (63%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           ALI++PTRELA Q    + A+G H    C   IGG++V
Sbjct: 151 ALIISPTRELALQTFSTINAVGAHHGFSCGLVIGGSDV 188


>AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform c protein.
          Length = 660

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E F++      ++  +   G+ KP+ +Q+ +I   +  RD+++ AQ+G+GK
Sbjct: 138 IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGK 189



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQL 451
           AL+L+PTRELA QI K         N +     GG  N R+ + +L
Sbjct: 225 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRL 270


>AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform b protein.
          Length = 644

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E F++      ++  +   G+ KP+ +Q+ +I   +  RD+++ AQ+G+GK
Sbjct: 122 IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGK 173



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQL 451
           AL+L+PTRELA QI K         N +     GG  N R+ + +L
Sbjct: 209 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRL 254


>AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform a protein.
          Length = 641

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E F++      ++  +   G+ KP+ +Q+ +I   +  RD+++ AQ+G+GK
Sbjct: 119 IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGK 170



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQL 451
           AL+L+PTRELA QI K         N +     GG  N R+ + +L
Sbjct: 206 ALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRL 251


>Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical
           protein C46F11.4 protein.
          Length = 811

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLY 275
           +F   +  + L+  I    +E+P+ IQ  AI   + GRDV+  A++G+GK    L+
Sbjct: 266 SFAHFSFDKLLMEAIRKSEYEQPTPIQAMAIPSALSGRDVLGIAKTGSGKTAAYLW 321


>Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical
           protein R05D11.4 protein.
          Length = 581

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++  F D ++   LL  +      +PS IQ ++I    + R+V+A A +G+GK L
Sbjct: 124 IILRFSDSSMSPSLLNRLSENSIRQPSPIQMQSIPFMTERRNVLASAPTGSGKTL 178


>AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical
           protein Y54G11A.3 protein.
          Length = 504

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           GFEKPS IQ +     + G+D I  +Q+G+GK L  L
Sbjct: 103 GFEKPSPIQSQMWPLLLSGQDCIGVSQTGSGKTLAFL 139



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 11/57 (19%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQ-----------ALILAPTRELAQQIQ 361
           C   S   + KT  F +  L  ID  + + +            L+L+PTRELAQQI+
Sbjct: 124 CIGVSQTGSGKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIE 180


>AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical
           protein Y55F3BR.1 protein.
          Length = 728

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  +  EL   + +  +  P+A+Q  AI   + G D +  A++G+GK
Sbjct: 4   FEEFGIIPELSDALSSLNWTLPTAVQSEAIPAILGGADALIAAETGSGK 52


>U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical
           protein F55F8.2b protein.
          Length = 579

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +2

Query: 296 TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           T +R  +ALI+APTREL  QI K + AL         + +GG
Sbjct: 64  TEVRGPRALIVAPTRELVIQIMKHINALISTTQLIATSIVGG 105


>U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical
           protein F55F8.2a protein.
          Length = 746

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +2

Query: 296 TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           T +R  +ALI+APTREL  QI K + AL         + +GG
Sbjct: 231 TEVRGPRALIVAPTRELVIQIMKHINALISTTQLIATSIVGG 272


>AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical
           protein H27M09.1 protein.
          Length = 630

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAY-GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           + +F +M   + LL  +    G   P+AIQ + I   + GRD+I  A +G+GK +
Sbjct: 188 IGSFLEMKFPKSLLEFMQKQKGIVTPTAIQIQGIPVALSGRDMIGIASTGSGKTM 242



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHL------NAKCHACIGGTNVREDIRQL 451
           LI+ P+RELA+QI  ++I + D L        +   CIGG  + E  + +
Sbjct: 270 LIIVPSRELARQIFDLIIEMFDALGKAGLPEMRAGLCIGGVPIGEQAKDV 319


>AL132948-1|CAC51077.1|  735|Caenorhabditis elegans Hypothetical
           protein Y39B6A.1 protein.
          Length = 735

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHG-HWCHQCKHGI*HSSDH 381
           HH   HH+P     HG H  H   HG  HS  H
Sbjct: 528 HHGEHHHAPAHHGHHGEHGTHHGHHGSHHSPAH 560



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/33 (39%), Positives = 16/33 (48%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 378
           HH   HH+P     HGH  H   HG+ H   H+
Sbjct: 563 HHGEHHHAPAH---HGHHGHHGSHGV-HHGHHE 591


>AC006696-10|AAF39990.1|  228|Caenorhabditis elegans Hypothetical
           protein W08E12.1 protein.
          Length = 228

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPPSE 357
           ++H H   +P   Y H H+ H   H   H+  +Q LS PS+
Sbjct: 14  SYHEHAELNPHDHYHHHHYPHSSVH---HTECYQTLSCPSD 51


>Z34989-1|CAA84441.1|  404|Caenorhabditis elegans Ndr protein kinase
           protein.
          Length = 404

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 439 YSPTGEWCSCTWWALQGRVYDMII 510
           + P G   SC WW+L   +Y+M+I
Sbjct: 234 FQPNGYTKSCDWWSLGVIMYEMLI 257


>U41016-7|ABC71807.1|  476|Caenorhabditis elegans Sensory axon
           guidance protein 1,isoform a protein.
          Length = 476

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 439 YSPTGEWCSCTWWALQGRVYDMII 510
           + P G   SC WW+L   +Y+M+I
Sbjct: 292 FQPNGYTKSCDWWSLGVIMYEMLI 315


>U41016-6|ABC71808.1|  474|Caenorhabditis elegans Sensory axon
           guidance protein 1,isoform b protein.
          Length = 474

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 439 YSPTGEWCSCTWWALQGRVYDMII 510
           + P G   SC WW+L   +Y+M+I
Sbjct: 292 FQPNGYTKSCDWWSLGVIMYEMLI 315


>AF275634-1|AAF91417.1|  469|Caenorhabditis elegans SAX-1 Ndr
           protein kinase protein.
          Length = 469

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 439 YSPTGEWCSCTWWALQGRVYDMII 510
           + P G   SC WW+L   +Y+M+I
Sbjct: 285 FQPNGYTKSCDWWSLGVIMYEMLI 308


>Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical
           protein F58G11.2 protein.
          Length = 960

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVV 370
           ALILAPTRELA QI + +
Sbjct: 462 ALILAPTRELAAQIHEAL 479


>Z50109-6|CAA90439.2|  344|Caenorhabditis elegans Hypothetical
           protein C09H10.8 protein.
          Length = 344

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/58 (24%), Positives = 30/58 (51%)
 Frame = -2

Query: 603 WIWSLENLWNNIFISFIKNKKFDGVGMKAHDDYHIIYTTLECPPRT*TPLSSWRISSR 430
           W+W+L +L   +  ++ +N +F  +  +  D  +I+    +C P     L S+R+ +R
Sbjct: 49  WVWALVDLPETMHATYKENAQFLNIINQVRDFLNILIKVHKCDPEMIKTL-SFRLGAR 105


>U21308-11|AAB93312.3|  265|Caenorhabditis elegans Roller: helically
           twisted, animalsroll when moving protein 8, isoform b
           protein.
          Length = 265

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%)
 Frame = +2

Query: 2   PEDSKNGPSKDQGSYDGPPGM--DPGTLAH 85
           P   K  P  D  SY GPPG   D GT  H
Sbjct: 202 PPGPKGNPGPDGQSYQGPPGPPGDSGTPGH 231


>U21308-10|AAN65281.1|  329|Caenorhabditis elegans Roller: helically
           twisted, animalsroll when moving protein 8, isoform a
           protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%)
 Frame = +2

Query: 2   PEDSKNGPSKDQGSYDGPPGM--DPGTLAH 85
           P   K  P  D  SY GPPG   D GT  H
Sbjct: 266 PPGPKGNPGPDGQSYQGPPGPPGDSGTPGH 295


>M25477-1|AAA27991.1|  329|Caenorhabditis elegans collagen protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%)
 Frame = +2

Query: 2   PEDSKNGPSKDQGSYDGPPGM--DPGTLAH 85
           P   K  P  D  SY GPPG   D GT  H
Sbjct: 266 PPGPKGNPGPDGQSYQGPPGPPGDSGTPGH 295


>AC084197-31|AAG23466.1|  105|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.22 protein.
          Length = 105

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +1

Query: 442 SPTGEWCSCTWWALQGRVYDMIIVVRFHANTIKLFVLDEADENVVPE 582
           SP  EW + T W L   +  +  ++R+   T++L    + D++ V E
Sbjct: 40  SPIPEWRAYTQWILIAALLVIFCILRYGVETVELHPTAKKDQDPVIE 86


>AC084155-1|AAG23361.2|  352|Caenorhabditis elegans Hypothetical
           protein Y45G5AM.6 protein.
          Length = 352

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = -3

Query: 497 YTRPWSAHHVHEHHSPVGEYLHGHWCHQ 414
           YTR        E +   G    GHWCH+
Sbjct: 110 YTRTIQCRECSEKNPNCGSSCEGHWCHE 137


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,375,172
Number of Sequences: 27780
Number of extensions: 415556
Number of successful extensions: 1276
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 1140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1268
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1708383636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).